IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ jin-2000-2 Hepatitis C virus core protein-induced loss of LZIP function correlates with cellular transformation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Jin DY., Wang HL., Zhou Y., Chun AC., Kibler KV., Hou YD., Kung H., Jeang KT. Apoptosis - Interactions involving proteins with a function related to apoptosis 2a and 4 dyjin@hkucc.hku.hk A human liver cDNA library was used EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer jin-2000-3 Hepatitis C virus core protein-induced loss of LZIP function correlates with cellular transformation. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Jin DY., Wang HL., Zhou Y., Chun AC., Kibler KV., Hou YD., Kung H., Jeang KT. Apoptosis - Interactions involving proteins with a function related to apoptosis 2b dyjin@hkucc.hku.hk A human liver cDNA library was used EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer jin-2000-4 Hepatitis C virus core protein-induced loss of LZIP function correlates with cellular transformation. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Jin DY., Wang HL., Zhou Y., Chun AC., Kibler KV., Hou YD., Kung H., Jeang KT. Apoptosis - Interactions involving proteins with a function related to apoptosis 2b dyjin@hkucc.hku.hk A human liver cDNA library was used EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer jin-2000-1 Hepatitis C virus core protein-induced loss of LZIP function correlates with cellular transformation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Jin DY., Wang HL., Zhou Y., Chun AC., Kibler KV., Hou YD., Kung H., Jeang KT. Apoptosis - Interactions involving proteins with a function related to apoptosis dyjin@hkucc.hku.hk A human liver cDNA library was used EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer jin-2000-5 Hepatitis C virus core protein-induced loss of LZIP function correlates with cellular transformation. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jin DY., Wang HL., Zhou Y., Chun AC., Kibler KV., Hou YD., Kung H., Jeang KT. Apoptosis - Interactions involving proteins with a function related to apoptosis 2c dyjin@hkucc.hku.hk A human liver cDNA library was used EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer polg_hcvtw Genome polyprotein protein protein hcvtw Hepatitis C virus genotype 1b (isolate Taiwan) (HCV) MSTNGKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTWERSQPRGRRQPIPKARQPEGRAWAQPGYPWPLYGNEGLGWAGWLVSPRGSRPNWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGVARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTIPASAYEVHNVSGIYHVTNDCSNSSIVYEAADMIMHTPGCVPCVRENNSSRCWVALTPTLAARNNSVPTATIRRHVDLLVGAAAFCSAMYVGDLCGSVFLVSQLFTFSPRRYETVQDCNCSIYPGHVTGHRMAWDMMMNWSPTTALVVSQLLRIPQAVVDMVGGAHWGVLAGLAYYSMVGNWAKVLIVMLLFAGVDGSTIVSGGTVARTTHSLASLFTQGASQKIQLINTNGSWHINRTALNCNDSLQTGFLASLFYAHRFNASGCPERMASCRSIDKFDQGWGPITYTEADIQDQRPYCWHYAPRPCGIVPASQVCGPVYCFTPSPVVVGTTDRFGAPTYSWGENETDVLILNNTRPPQGNWFGCTWMNSTGFTKTCGGPPCNIGGGGNNTLVCPTDCFRKHPEATYTKCGSGPWLTPRCMVDYPYRLWHYPCTVNFTIFKVRMYVGGVEHRLNAACNWTRGERCDLEDRDRSELSPLLLSTTEWQILPCSFTGLPALSTGLIHLHQNVVDVQYLYGIGSAVVSFAIKWEYILLLFLLLADARVCACLWMMLLIAQAEAALENLVVFNAASVAGMHGTLSFLVFFCAAWYIKGRLVPGAAYALYGVWPLLLLLLALPPRAYAMDREMAASCGGAVFVGLVLLTLSPHYKMFLARLIWWLQYFITRAEAHLQVWIPPLNVRGGRDAIILLTCAAYPELIFDITKILLAILGPLMVLQAGLTRIPYFVRAQGLIRACMLVRKAAGGHYVQMALMKLAALTGTYVYDHLTPLQDWAHTGLRDLAVAVEPVVFSDMETKIITWGADTAACGDIILGLPVSARRGREILLGPADSLEGRGWRLLAPITAYAQQTRGLFGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCINGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWHAPQGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQAFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIMCDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEIALSNTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSALGIHAVAYYRGLDVSVIPASGNVVVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTMPQDAVSRSQRRGRTSRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLTRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVTSTWVLVGGVLAALAAYCLTTGSVVIVGRIILSGKPAVVPDREVLYQEFDEMEECASHLPYIEQGMQLAEQFKQKALGLLQTATKQAEAAAPVVESKWRTLEAFWANDMWNFISGIQYLAGLSTLPGNPAIASLMAFTASITSPLTTQSTLLFNILGGWVAAQLAPPGAASAFVGAGIAGAAVGSIGLGKVLVDMVAGYGAGVAGALVAFKVMSGEMPSTEDLVNLLPAILSPGALVVGVVCAAILRRHVDPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDAAARVTQILSGLTITQLLRRLHQWINEDCSTPCSGSWLRDVWDWICTVLADFKTWLQSKLLPRLPGVPFFSCQRGYKGVWRGDGIMQTTCPCGAQLTGHVKNGSMRIWGPKTCSNTWHGTFPINAYTTGPCTPSPAPNYSRALWRVAAEEYVEVRRVGDFHYVTGMTTDNVKCPCQVPAPEFFTEVDGVRLHRYAPACKPLLREEVSFQVGLNQYVVGSQLPCEPEPDVAVLTSMLTDPSHITAETAKRRLARGSPPSLASSSASQLSALSLKAACTTRHTPPDADLIEANLLWRQEMGGNITRVESENKVVILDSFDPLRAEEDEREVSVPAEILRKSRKFPPALPVWARPDYNPPLLEPWKDPDYVPPVVHGCPLPPVKAPPIPPPRRKRTVVLTESTVSSALAELATKTFGSSESSAAGSGTATAPPDQPSDDGDAGSDVESCSSMPPLEGEPGDPDLSDGSWSTVSEEDGEGVICCSMSYTWTGALITPCAAEESKLPINALSNSLLRHHNMVYATTSRSASQRQKKVTIDRLQVLDDHYRDVLKEMKAKASTVKAKLLSVEEACKLTPPHSARSKFGYGAKDVRNLSGKAINHIRSVWKDLLEDTETPIDTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVSTLPQAVMGSSYGFQYSPGQRVEFLVNAWKSKKCPMGFSYDTRCFDSTVTESDIRVEESIYQCCDLAPEARQAIRSLTERLYIGGPLTNSKGQNCGYRRCRASGVLTTSCGNTLTCYLKASAACRAAKLQDCTMLVCGDDLVVICESAGTQEDAASLRVFTEAMTRYSAPPGDLPQPEYDQELITSCSSNVSVAHDASGKRVYYLTRDPTTPLARAAWATARHTPVNSWLGNIIMYAPTLWARMILMTHFFSILLAQEQLEKALDCQIYGACYSIEPLDLPQIIERLHGLSAFSLHSYSPGEINRVASCLRKLGVPPLRAWRHRARSVRAKLLSQGGRAATCGRYLFNWAVKTKLKLTPIPAASQLDLSKWFVAGYGGGDIYHSLSRARPRWFMLCLLLLSVGVGIYLLPNR o43889-2 Cyclic AMP-responsive element-binding protein 3 CREB3 LZIP Luman Transcription factor LZIP-alpha LZIP Leucine zipper protein protein protein human Homo sapiens Human MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG hcv-lzip-3 Interaction between hepatitis C virus core protein and human LZIP detected by Y2H 360551 N/A 360556 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 360557 unspecified role unspecified role prey prey physical association physical association false false false lzip-lzip-1 Homodimerisation of human LZIP detected by Y2H 360551 N/A 360557 unspecified role unspecified role prey prey N/A 360557 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false lzip-hcv-1 interaction between human LZIP and hepatitis C virus core protein detected by Y2H 360551 N/A 360556 unspecified role unspecified role prey prey N/A 360557 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false hcv-lzip-4 Interaction between hepatitis C virus core protein and human LZIP detected by coIP 360552 N/A 360556 unspecified role unspecified role bait bait N/A 360557 unspecified role unspecified role prey prey gal 4 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false hcv-lzip-5 Interaction between hepatitis C virus core protein and human LZIP detected by coIP 360552 N/A 360556 unspecified role unspecified role bait bait gal 4 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 360557 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false hcv-lzip-6 Interaction between hepatitis C virus core protein and human LZIP detected by coIP 360553 N/A 360556 unspecified role unspecified role bait bait N/A 360557 unspecified role unspecified role prey prey gal 4 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false hcv-lzip-7 Interaction between hepatitis C virus core protein and human LZIP detected by coIP 360553 N/A 360556 unspecified role unspecified role bait bait gal 4 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 360557 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false hcv-lzip-1 Interaction between hepatitis C virus core protein and human LZIP detected by Y2H 360554 N/A 360556 unspecified role unspecified role bait bait N/A 360557 unspecified role unspecified role prey prey physical association physical association false false false hcv-lzip-8 Interaction between hepatitis C virus core protein and human LZIP detected by affinity chromatography 360555 N/A 360556 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 360557 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false