IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yang-2000-1 The winged-helix/forkhead protein myocyte nuclear factor beta (MNF-beta) forms a co-repressor complex with mammalian sin3B. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Yang Q., Kong Y., Rothermel B., Garry DJ., Bassel-Duby R., Williams RS. Cancer - Interactions investigated in the context of cancer An adult mouse cardiac cDNA library was screened williams@ryburn.swmed.edu Biochem. J. (0264-6021) 2000 Only protein-protein interactions imex curation yang-2000-2 The winged-helix/forkhead protein myocyte nuclear factor beta (MNF-beta) forms a co-repressor complex with mammalian sin3B. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yang Q., Kong Y., Rothermel B., Garry DJ., Bassel-Duby R., Williams RS. Cancer - Interactions investigated in the context of cancer An adult mouse cardiac cDNA library was screened 1 williams@ryburn.swmed.edu Biochem. J. (0264-6021) 2000 Only protein-protein interactions imex curation yang-2000-3 The winged-helix/forkhead protein myocyte nuclear factor beta (MNF-beta) forms a co-repressor complex with mammalian sin3B. mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Q., Kong Y., Rothermel B., Garry DJ., Bassel-Duby R., Williams RS. Cancer - Interactions investigated in the context of cancer An adult mouse cardiac cDNA library was screened 1B williams@ryburn.swmed.edu Biochem. J. (0264-6021) 2000 Only protein-protein interactions imex curation yang-2000-4 The winged-helix/forkhead protein myocyte nuclear factor beta (MNF-beta) forms a co-repressor complex with mammalian sin3B. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa predetermined predetermined participant predetermined Yang Q., Kong Y., Rothermel B., Garry DJ., Bassel-Duby R., Williams RS. Cancer - Interactions investigated in the context of cancer An adult mouse cardiac cDNA library was screened 3C williams@ryburn.swmed.edu Biochem. J. (0264-6021) 2000 Only protein-protein interactions imex curation foxk1_mouse Forkhead box protein K1 Myocyte nuclear factor Foxk1 Mnf protein protein mouse Mus musculus Mouse MAEVGEDSGARALLALRSAPCSPVLCAAAAAAAFPATTSPPPPAQPPPGPPALPAEPGPGPVPSTVATATTTAPALVAAAAASVRQSPGPALARLEGREFEFLMRQPSVTIGRNSSQGSVDLSMGLSSFISRRHLQLSFQEPHFYLRCLGKNGVFVDGAFQRRGAPALQLPQQCTFRFPSTAIKIQFTSLYHKEEAPASPLRPLYPQISPLKIHIPEPDLRSLVSPIPSPTGTISVPNSCPASPRGAGSSSYRFVQNVTSDLQLAAEFAAKAASEQQADASGGDSPKDESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASPTHPGLMSPRSSGLQTPECLSREGSPIPHDPDLGSKLASVPEYRYSQSAPGSPVSAQPVIMAVPPRPSNLVAKPVAYMPASIVTSQQPSGHAIHVVQQAPTVTMVRVVTTSANSANGYILASQGSTGTSHDTAGTAVLDLGNEARGLEEKPTIAFATIPAASRVIQTVASQMAPGVPGHTVTILQPATPVTIGQHHLPVRAVTQNGKHAVPTNSLTGNAYALSSPLQLLAAQASSSTPVVITRVCEVGPEEPAAAVSVAANAAPTPAASTTTSASSSGEPEVKRSRVEEPGGTATTQPTAMAATGPQGPGTGE q62141-2 Paired amphipathic helix protein Sin3b Sin3b Kiaa0700 Histone deacetylase complex subunit Sin3b Transcriptional corepressor Sin3b protein protein mouse Mus musculus Mouse MAHAGSGGSAGRGFGGSRWGRSGSGGHEKLPVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNIQSPLSSQDNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTGNGSCEMNSGQKNEEKSLEHNKKRSRPSLLRPVSAPAKVGLQLKCAVVWFGYCTAEE dna dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid in vitro In vitro GTACTGTAAATAAATAGTGCCGCGGTACCAGATC mnfb-sin3b-1 Interaction between mouse MNF beta and Sin3B detected by Y2H 357299 n/a 357303 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 357304 unspecified role unspecified role prey prey physical association physical association false false false mnfa-sin3b-1 Interaction between mouse MNF alpha and Sin3B detected by Y2H 357299 N/A 357304 unspecified role unspecified role prey prey n/a 357303 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false mnfb-sin3b-2 Interaction between mouse MNF beta and Sin3B detected by Y2H 357299 N/A 357304 unspecified role unspecified role prey prey n/a 357303 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false mnfa-sin3b-2 Interaction between mouse MNF alpha and Sin3B detected by Y2H 357299 N/A 357304 unspecified role unspecified role prey prey n/a 357303 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false sin3b-mnfb-1 interaction between mouse Sin3B and MNF beta detected by GST pulldown 357300 n/a 357303 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 357304 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false sin3b-mnfa-1 interaction between mouse Sin3B and MNF alpha detected by GST pulldown 357300 n/a 357303 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 357304 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false mnfa-sin3b-3 Interaction between mouse MNF alpha and Sin3B detected by coiP 357301 n/a 357303 unspecified role unspecified role bait bait N/A 357304 unspecified role unspecified role prey prey n terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false mnfb-sin3b-3 Interaction between mouse MNF beta and Sin3B detected by coiP 357301 n/a 357303 unspecified role unspecified role bait bait N/A 357304 unspecified role unspecified role prey prey n terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false mnfa-dna-1 Binding of mouse MNF alpha to DNA 357302 N/A 357305 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 357303 unspecified role unspecified role neutral component neutral component in vitro In vitro direct interaction direct interaction false false false mnfb-dna-1 Binding of mouse MNF beta to DNA 357302 N/A 357305 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 357303 unspecified role unspecified role neutral component neutral component in vitro In vitro direct interaction direct interaction false false false