IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ vakifahmeto-2006-1 Functional connection between p53 and caspase-2 is essential for apoptosis induced by DNA damage. human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Vakifahmetoglu H., Olsson M., Orrenius S., Zhivotovsky B. Apoptosis - Interactions involving proteins with a function related to apoptosis Untreated or 5-FU-treated p53+/+ and p53-/- HCT116 cells were harvested at 24 h and used in this assay. Oncogene (0950-9232) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology vakifahmeto-2006-2 Functional connection between p53 and caspase-2 is essential for apoptosis induced by DNA damage. human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Vakifahmetoglu H., Olsson M., Orrenius S., Zhivotovsky B. Apoptosis - Interactions involving proteins with a function related to apoptosis Untreated or 5-FU-treated p53+/+ and p53-/- HCT116 cells were harvested at 24 h and used in this assay. Oncogene (0950-9232) 2006 Only protein-protein interactions imex curation BioCreative - Critical Assessment of Information Extraction systems in Biology pidd1_human p53-induced death domain-containing protein 1 PIDD1 LRDD Leucine-rich repeat and death domain-containing protein PIDD protein protein human Homo sapiens Human MAATVEGPELEAAAAAGDASEDSDAGSRALPFLGGNRLSLDLYPGGCQQLLHLCVQQPLQLLQVEFLRLSTHEDPQLLEATLAQLPQSLSCLRSLVLKGGQRRDTLGACLRGALTNLPAGLSGLAHLAHLDLSFNSLETLPACVLQMRGLGALLLSHNCLSELPEALGALPALTFLTVTHNRLQTLPPALGALSTLQRLDLSQNLLDTLPPEIGGLGSLLELNLASNRLQSLPASLAGLRSLRLLVLHSNLLASVPADLARLPLLTRLDLRDNQLRDLPPELLDAPFVRLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLACGVRLQFPAGATATPITIRYRLLLPEPGLVPLGPHDALLSHVLELQPHGVAFQQDVGLWLLFTPPQARRCREVVVRTRNDNSWGDLETYLEEEAPQRLWAHCQVPHFSWFLVVSRPVSNACLVPPEGTLLCSSGHPGVKVIFPPGATEEPRRVSMQVVRMAGRELQALLGEPEAAVSPLLCLSQSGPPSFLQPVTVQLPLPSGITGLSLDRSRLHLLYWAPPAATWDDITAQVVLELTHLYARFQVTHFSWYWLWYTTKNCVGGLARKAWERLRLHRVNLIALQRRRDPEQVLLQCLPRNKVDATLRRLLERYRGPEPSDTVEMFEGEEFFAAFERGIDVDADRPDCVEGRICFVFYSHLKNVKEVYVTTTLDREAQAVRGQVSFYRGAVPVRVPEEAEAARQRKGADALWMATLPIKLPRLRGSEGPRRGAGLSLAPLNLGDAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLAPKDPALPGSSAPQPPEPAQA cradd_human Death domain-containing protein CRADD Caspase and RIP adapter with death domain RIP-associated protein with a death domain CRADD RAIDD protein protein human Homo sapiens Human MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE casp2_human Caspase-2 Protease ICH-1 Neural precursor cell expressed developmentally down-regulated protein 2 CASP2 ICH1 NEDD2 protein protein human Homo sapiens Human MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT casp2-raidd-pidd Coimmunoprecipitation assay reveals interaction between CASP2, PIDDand RAIDD proteins 506705 N/A 506707 unspecified role unspecified role prey prey N/A 506708 unspecified role unspecified role prey prey N/A 506709 unspecified role unspecified role bait bait association association false false false Figure 5a casp2-raidd-pidd-1 Coimmunoprecipitation assay reveals interaction between CASP2, PIDDand RAIDD proteins 506705 N/A 506708 unspecified role unspecified role bait bait N/A 506707 unspecified role unspecified role prey prey N/A 506709 unspecified role unspecified role prey prey association association false false false Figure 5b casp2-raidd-pidd-2 Coimmunoprecipitation assay reveals interaction between CASP2, PIDDand RAIDD proteins 506705 N/A 506709 unspecified role unspecified role prey prey N/A 506708 unspecified role unspecified role bait bait physical association physical association false false false Figure 5c casp2-pidd-3 Interaction CASP2 and PIDD proteins 506706 N/A 506709 unspecified role unspecified role neutral component neutral component N/A 506707 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Figure 6a and 6b raidd-pidd-4 Interaction between RAIDD and PIDD proteins 506706 N/A 506708 unspecified role unspecified role neutral component neutral component N/A 506707 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Figure 6c and 6d