IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mao-2006a-1 APPL1 binds to adiponectin receptors and mediates adiponectin signalling and function. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mao X., Kikani CK., Riojas RA., Langlais P., Wang L., Ramos FJ., Fang Q., Christ-Roberts CY., Hong JY., Kim RY., Liu F., Dong LQ. BioCreative - Critical Assessment of Information Extraction systems in Biology dongq@uthscsa.edu Human fetal brain cDNA library Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation mao-2006a-2 APPL1 binds to adiponectin receptors and mediates adiponectin signalling and function. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mao X., Kikani CK., Riojas RA., Langlais P., Wang L., Ramos FJ., Fang Q., Christ-Roberts CY., Hong JY., Kim RY., Liu F., Dong LQ. BioCreative - Critical Assessment of Information Extraction systems in Biology dongq@uthscsa.edu Human fetal brain cDNA library Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation mao-2006a-3 APPL1 binds to adiponectin receptors and mediates adiponectin signalling and function. mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast pull down pull down western blot western blot Immuno blot Immuno blot Mao X., Kikani CK., Riojas RA., Langlais P., Wang L., Ramos FJ., Fang Q., Christ-Roberts CY., Hong JY., Kim RY., Liu F., Dong LQ. BioCreative - Critical Assessment of Information Extraction systems in Biology dongq@uthscsa.edu Human fetal brain cDNA library Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation mao-2006a-4 APPL1 binds to adiponectin receptors and mediates adiponectin signalling and function. mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mao X., Kikani CK., Riojas RA., Langlais P., Wang L., Ramos FJ., Fang Q., Christ-Roberts CY., Hong JY., Kim RY., Liu F., Dong LQ. BioCreative - Critical Assessment of Information Extraction systems in Biology Cells were treated with adiponectin (2 micro gram per litre) or untreated prior to assay. dongq@uthscsa.edu Human fetal brain cDNA library Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation paqr1_mouse Adiponectin receptor protein 1 Adipor1 Parq1 Progestin and adipoQ receptor family member 1 Progestin and adipoQ receptor family member I protein protein mouse Mus musculus Mouse MSSHKGSAGAQGNGAPSGNREADTVELAELGPLLEEKGKRAASSPAKAEEDQACPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDSLL dp13a_human DCC-interacting protein 13-alpha Adapter protein containing PH domain, PTB domain and leucine zipper motif 1 APPL1 APPL DIP13A KIAA1428 protein protein human Homo sapiens Human MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRKAGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESKKDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPAAGQSRPPTARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTNPFGESGGSTKSETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGKKRESEA dp13b_mouse DCC-interacting protein 13-beta Adapter protein containing PH domain, PTB domain and leucine zipper motif 2 Appl2 Dip13b Dip3b protein protein mouse Mus musculus Mouse MPAVDKLLLEEALQDSPQARSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQLSRQLLAYEKQNFALGKGDEEVISTLHYFSKVMDELNGLHTELAKQLADTMVLPVIQFREKDLTEVSTLKDLFGLASSEHDLSMAKYSRLPKKKENEKAKTEIVKEVAAARRKQHLSSLQYYCALNALQYRKRAAMMEPLIGFAHGQINFFKRGAEMFSKSMDGFLSSVKDMVQSIQVELEAEADKMRVSQQELLSVSESVYTPDIDVATAQINRNLIQKTGYLNLRNKTGLVTTTWERLYFFTQGGNLMCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQISTPSGKPGIILQAESRKEYEEWICAVNNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESSCSSQNIKNSDIEDDNIVPKATASIPETEELIAPGTPIQFDIVLPATEFLDQNRGGRRTNPFGETEDGSFPEAEDSLLQQMFIVRFLGSMAVKTDSTAEVIYEAMRQVLAARAIHNIFRMTESHLMVTSQTLRLIDPQTQVSRACFELTSVTQFAAHQENKRLVGFVIRVPESTGEESLSTYIFESNSEGEKICYAINLGKEIIEVQKDPEALARLMLSVPLTNDGKYVLLNDQADDTGGSPSENRGAESEA adipor1-appl1 Yeast two hybrid assay reveals interaction between Adipor1 protein and APPL1 protein 506055 N/A 506059 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 506060 unspecified role unspecified role prey prey physical association physical association false false false The C terminus coordinates of the binding region of Dip13b was not given in the text adipro1-appl1 Directed yeast two hybrid assay reveals interaction between Adipor1 protein and APPL1 protein 506056 N/A 506060 unspecified role unspecified role prey prey c terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 506059 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 1a paqr1-dip13b-2 GST pulldown assay reveals interaction between PAQR1 protein and Dip13b protein 506057 N/A 506060 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 506059 unspecified role unspecified role prey prey physical association physical association false false false Figure 1d paqr1-dip13b-3 Coimmunoprecipitation assay reveals interaction between PAQR1 protein and Dip13b protein 506058 N/A 506061 unspecified role unspecified role bait bait N/A 506059 unspecified role unspecified role prey prey physical association physical association false false false Figure 1e adiponectin