IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sanematsu-2006-1 Asf1 is required for viability and chromatin assembly during DNA replication in vertebrate cells. chick-dt40 Gallus gallus bursa lymphoma dt40 chicken bursa lymphoma http://www.lgcpromochem-atcc.com/common/catalog/numSearch/numResults.cfm ATCC Number:CRL-2111 chicken bursa lymphoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sanematsu F., Takami Y., Barman HK., Fukagawa T., Ono T., Shibahara K., Nakayama T. BioCreative - Critical Assessment of Information Extraction systems in Biology tnakayam@med.miyazaki-u.ac.jp J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation sanematsu-2006-2 Asf1 is required for viability and chromatin assembly during DNA replication in vertebrate cells. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sanematsu F., Takami Y., Barman HK., Fukagawa T., Ono T., Shibahara K., Nakayama T. BioCreative - Critical Assessment of Information Extraction systems in Biology tnakayam@med.miyazaki-u.ac.jp J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation sanematsu-2006-3 Asf1 is required for viability and chromatin assembly during DNA replication in vertebrate cells. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sanematsu F., Takami Y., Barman HK., Fukagawa T., Ono T., Shibahara K., Nakayama T. BioCreative - Critical Assessment of Information Extraction systems in Biology tnakayam@med.miyazaki-u.ac.jp J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation asf1_chick Histone chaperone ASF1 Anti-silencing function protein 1 homolog ASF1 protein protein chick Gallus gallus (Chicken) Chicken MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLESHMDCM caf1b_chick Chromatin assembly factor 1 subunit B CHAF1B CAF1P60 Chromatin assembly factor I p60 subunit RCJMB04_5h12 protein protein chick Gallus gallus (Chicken) Chicken MKVITCEIAWHNKEPVYSLDFQHGTDGKINRLASAGVDTAVRVWKVEKGPDGKAIVEFLSNLARHTKAVNVVRFSPSGEVLASGGDDAVILLWKLNDSKELEPLAFQDEDEAQLNKENWTVVKTLRGHLEDVYDICWTSDGNYMASASVDNTAIMWDVVKGQKVSILNEHKSYVQGITWDPLGQYIATLSCDRVLRVYNTQTKRVAFNVTKMPSESGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENVTNTTYVFSRNNLKRPMGHLPCPGKATLAVRCCPVYFELRQALNKGEVSQKSSPALLNLPYRLVFAVASEDSVLFYDTEQSFPFGYVSNIHYHTLSDISWSSDGAFLAISSTDGYCSFVTFEKDELGIPLKEKPQIHVRTSVVTEKKVKKSQPNKVISPGSRLTEGTSLSTPTLQPKTPVAAAKDLPSTPVGIKNVPVSSSEERKISQPASQSTKVNQPRRITLNTLQAWSKTPRRVNLIPLKPDTPASVYTDTVPVPPSSEQEHERPLPSGDSLQNPPASKRPRTEEMPLSVSAEDQIGCKPNK h4_chick Histone H4 H4-I H4-II H4-III H4-IV H4-V H4-VI H4-VII protein protein chick Gallus gallus (Chicken) Chicken MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG h32_chick Histone H3.2 H3-I H3-II H3-III H3-IV H3-V H3-VI H3-VII H3-VIII Histone H3 class I protein protein chick Gallus gallus (Chicken) Chicken MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA hira_chick Protein HIRA TUP1-like enhancer of split protein 1 HIRA TUPLE1 protein protein chick Gallus gallus (Chicken) Chicken MKLLKPTWVNHNGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMAPVLKEEDEKNENIPKMLCQMDNHLACVNCVRWSNNGVYLASGGDDKLIMVWKRAAYIGPSTVFGSSSKLTNVEQWRCVSILRSHSGDVMDVAWSPHDAWLASCSVDNTVVIWNAVKFPEILATLKGHSGLVKGLTWDPVGKYIASQADDRSLKVWRTMDWQLETSITKPFDECGGTTHVLRLSWSPDGHYLVSAHAMNNSGPTAQIIERDGWKTNMDFVGHRKAVTVVKFNPKIFKKKQKNGSSTKSSCPYCCCAVGSKDRSLSVWLTCLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAFLDFSQDELGDPLSEEEKSNIHQSTYGKSLAIMTEAQLSTTIIENPEMLKYQQRQQQQQAEQKNASIREASGAATTAPKVASMVNGESLEDIRKNLLKKQVETRTADGRRRITPLCIAQLDTGDFSTAFFNSIPISGTLAGSIMSSQNNQQLMSLDSNAANSLNTSKPSAEPTAASIKPTDDAASKDGVNATSVSTAPPASSSSVLTTPSKIEPMKAFDSRFTERSKATSGTAVVTNTNQTVVDRLKDQNLIKDNKPKDILESSSDSEEKIPAAKPLSAPKRKLELEGETVEKKKKGRPRKDSRLVPVTLTVQSPAALASEKDAACISAPALALKLPTPIPQKSFTLQVSSDPSMYLEVENEMTTVGGSKLSRLKCNREGKEWETVLTSRILTAAGSCEIVCVACEKRMLSVFSACGRRLLPPIILNTPISTLHCTGSYIMTLTTAATLSVWDVHKQTVIVRDESLQTILSGSDTTVSQILLTQHGIPVMSMSDGKAYCFNPSLSTWNLVSDKQDSLAQCADFRSSLPSQEAMLCSGPLAVIQGRTSNSGRQAARLFSMPHLVQQETTLAYLENQIAAALMLQSSHEYRHWLLIYARYLVNEGFEYRLRELCKDLLGPVHYSRGSQWESTVMGLRKRELLKELLPVIGQNLFQRLFTEYQEQLDIL asf1-hira 495494 N/A 495497 unspecified role unspecified role bait bait c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 495498 unspecified role unspecified role prey prey N/A 495499 unspecified role unspecified role prey prey lys12 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false N/A 495500 unspecified role unspecified role prey prey N/A 495501 unspecified role unspecified role prey prey association association false false false 5 The conditional knockout Asf1 in chick was HA tagged and the cells were allowed to recover for 24hrs to eliminate the effects of internal Asf1. asf1-hira-1 495495 N/A 495497 unspecified role unspecified role bait bait c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 495501 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 5C, 5D asf1-caf 495496 N/A 495497 unspecified role unspecified role bait bait c terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q3C1E9:p.Glu36_Asp37delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false N/A 495498 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5E