IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ juarez_diaz-2006-1 A novel thioredoxin h is secreted in Nicotiana alata and reduces S-RNase in vitro. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Juarez-Diaz JA., McClure B., Vazquez-Santana S., Guevara-Garcia A., Leon-Mejia P., Marquez-Guzman J., Cruz-Garcia F. BioCreative - Critical Assessment of Information Extraction systems in Biology Self incompatable Nicotiana alata S(105)S(105) were used as the source of protein extracts in this study. fcg@servidor.unam.mx J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation juarez_diaz-2006-2 A novel thioredoxin h is secreted in Nicotiana alata and reduces S-RNase in vitro. nical Nicotiana alata (Winged tobacco) Persian tobacco confocal microscopy confocal microscopy predetermined predetermined participant predetermined Juarez-Diaz JA., McClure B., Vazquez-Santana S., Guevara-Garcia A., Leon-Mejia P., Marquez-Guzman J., Cruz-Garcia F. Styles of self incompatable Nicotiana alata S(105)S(105) were used in this study. fcg@servidor.unam.mx J. Biol. Chem. (0021-9258) 2006 BioCreative - Critical Assessment of Information Extraction systems in Biology Self incompatable Nicotiana alata S(105)S(105) were used as the source of protein extracts in this study. Only protein-protein interactions imex curation q4u0w0_nical Trxh protein protein nical Nicotiana alata (Winged tobacco) Persian tobacco MGSYLSSLLGGGAAEAAEAESGSSSEPSRVIAFHSSNRWQLHFNSSKQLNKLIVVDFAATWCGPCKMMEPVINAMSAKYTDVDFVKIDVDELSDVAQEFGVQAMPTFLLLKQGKEVERVVGAKKDELEKKILKHREAPKFAASNYRTKFHVQ q40382_nical protein protein nical Nicotiana alata (Winged tobacco) Persian tobacco MKMASNSATSLFLTLFLITQCLSVLTAAQDFDFFYFVQQWPGSYCDTKQSCCYPKTGKPASDFGIHGLWPNNNDGSYPSNCDSNSPYDQSQVSDLISRMQQNWPTLACPSGTGSAFWSHEWEKHGTCSESIFDQHGYFKKALDLKNQINLLEILQGAGINPDGGFYSLNSIKNAIRSAIGYTPGIECNVDDSGNSQLYQVYICVDGSGSNLIECPVFPRGKCGSSIEFPTF trxh-rnase Affinity chromatography reveals interaction between Trxh and RNase 505659 N/A 505661 unspecified role unspecified role neutral component neutral component N/A 505662 unspecified role unspecified role neutral component neutral component physical association physical association false false false Figure 8 trxh-rnase-1 Affinity chromatography reveals interaction between Trxh and RNase 505660 N/A 505661 unspecified role unspecified role neutral component neutral component N/A 505662 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Figure 5 The proteins colocalised to the extra cellular matrix of the styles assayed.