IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sanderson_s-2006-1 Divergence in the plasminogen-binding group a streptococcal M protein family: functional conservation of binding site and potential role for immune selection of variants. in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Sanderson-Smith M., Batzloff M., Sriprakash KS., Dowton M., Ranson M., Walker MJ. BioCreative - Critical Assessment of Information Extraction systems in Biology Assays were carried out in the presence or absence of 50 fold molar excess of unlabelled Glu-plasminogen (UniProt accession number Q5TEH4) or unlabelled fluid phase PAM(NS13) (UniProt accession number Q6V4L5). mwalker@uow.edu.au J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation sanderson_s-2006-2 Divergence in the plasminogen-binding group a streptococcal M protein family: functional conservation of binding site and potential role for immune selection of variants. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Sanderson-Smith M., Batzloff M., Sriprakash KS., Dowton M., Ranson M., Walker MJ. BioCreative - Critical Assessment of Information Extraction systems in Biology Assays were carried out in the presence or absence of 50 fold molar excess of unlabelled Glu-plasminogen (UniProt accession number Q5TEH4) or unlabelled fluid phase PAM(NS13) (UniProt accession number Q6V4L5). mwalker@uow.edu.au J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation plmn_human Plasminogen PLG protein protein human Homo sapiens Human MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN q6v4l5_strpy protein protein strpy Streptococcus pyogenes RKLKTGTASVAVALTVVGAGLASQTEVKANRADDARNEVLRGNLVRAELWYRQIQENDQLKLENKGLKTDLREKEEELQGLKDDVEKLTADAELQRLKNERHEEAELERLKSERHDHDKKEAERKALEDKLADKQEHLNGALRYINEKEAERKEKEAEQKKLKEEKQISDASRQGLRRDLDASREAKKQVEKDLANLTAELDKVKEEKQISDASRQGLRRDLDASREAKKQVEKGLANLTAELDKVKEEKQISDASRQGLRRDLDASREAKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAELQAKLEAEAKALKEQLAKQAEELAKLRAEKASDSQTPDAKPGNKAVPGKGQAPQAGTKPNQNKAPMKETKRQLPSTSETT q6v4l9_strpy protein protein strpy Streptococcus pyogenes RKLKTGTASVAVALTVLGAGFANQTEVKAADHPSYTAAKDEVLSKFSVPGHVWAHEREKNDKLSSENEGLKAGLQEKEQELKNLKADVEKLKDAAELERLKNERHDHDELERLKNERHDHDKREAERKALEDKLADKQEHLDGALRYINEKEAERKEKEAEQKKLKEEKQISDASRQGLRRDLDASREAKKQVEKDLANLTAELDKVKEEKQISDASRQGLRRDLDASREAKKQVEKDLADLTAELDKVKEEKQISDASRQGLRRDLDASREAKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAELQAKLEAEAKALKEQLAKQAEELAKLRAEKASDSQTPDAKPGNKAVPGKGQAPQAGTKPNQNKAPMKETKRQLPSTGETT q6v4l4_strpy protein protein strpy Streptococcus pyogenes RKLKTGTASVAVALTVVGAGLASQTEVKADQPVDHHRYTEANNAVLQGRTVSARALLHEINKNGQLRSENEELKADLQKKEQELKNLNDDVKKLNDEVALERLKNERHVHDEEVELERLKNERHDHDKKEAERKALEDKLADKQEHLDGALRYINEKEAERKEKEAEQKKLKEEKQISDASRQGLRRDLDASREAKKQVEKDLANLTAELDKAKEEKQISDASRQGLRRDLDASREAKKQVEKDLANLTAELDKVKEEKQISDASRQGLRRDLDASREAKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAELQAKLEAEAKALKEKLAKQAEELAKLRAEKASDSQTPDAKPGNKAVPGKGQAPQAGTKPNQNKAPMKETKRQLPSTGETT q6v4l1_strpy protein protein strpy Streptococcus pyogenes RKLKTGTASVAVALTVVGAGLASQTEVKAENHPGYTAAQNGVLSELPGQAQAFSRAFLHEREKNGELRLENEGLKTDLKKKEQELESLKGDVEKLKDEVALERLKNERHVHDEEAELERLKNERYEHDKKEAERKALEDKLADKQEHLNGALRYINEKEAERKEKEAEQKKLKEEKQISDASRQGLRRDLDASREAKKQVEKDLANLTAELDKVKEEKQVSDASRQGLRRDLDASREAKKKVEADLAALTAEHQKLKEEKQISDASRQGLSRDLEASREAKKKVEADLAEANSKLQALEKLNKELEEGKKLSEKEKAELQARLEAEAKALKEQLAKQAEELAKLRAGKASDSQTPDAKPGNKAVPGKGQAPQAGTKPNQNKAPMKETKRQLPSTGETT q6v4k9_strpy protein protein strpy Streptococcus pyogenes RKLKTGTASVAVALTVVGAGLASQTEVKADQPVDHHRYTEANNAVLQGRTVSARALLHEINKNGQLRSENEELKADLQKKEQELKNLNDDVKKLNDEVALERLKNERHVHDEEVELERLKNERHDHDKKEAERKALEDKLADKQEHLDGALRYINEKEAERKEKEAEQKKLKEEKQISDASRQGLRRDLDASREAKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAELQAKLEAEAKALKEKLAKQAEELAKLRAEKASDSQTPDAKPGNKAVPGKGQAPQAGTKPNQNKAPMKETKRQLPSTG plg-q6v4l5 Competition binding assay reveals interaction between Plasminogen and Q6V4L5 504102 N/A 504104 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false glu N-terminal Glu residue experimental feature experimental feature n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 504105 unspecified role unspecified role bait bait c terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 3 Figure 4 Table 2 The circulating form of plasminogen was isolated from Human plasma which has a Glutamic acid residue attached to the N-termini of the plasminogen protein. Effective concentration of competitor (unlabelled Q6V4L5) required to inhibit binding by 50% (EC50) was 22.06 micro Molar. plg-q6v4l9 Competition binding assay reveals interaction between Plasminogen and Q6V4L9 504102 N/A 504104 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false glu N-terminal Glu residue experimental feature experimental feature n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 504106 unspecified role unspecified role bait bait c terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 3 Figure 4 Table 2 The circulating form of plasminogen was isolated from Human plasma which has a Glutamic acid residue attached to the N-termini of the plasminogen protein. Effective concentration of competitor (unlabelled Q6V4L9) required to inhibit binding by 50% (EC50) was 0.68 micro Molar. plg-q6v4l4 Competition binding assay reveals interaction between Plasminogen and Q6V4L4 504102 N/A 504107 unspecified role unspecified role bait bait c terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 504104 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false glu N-terminal Glu residue experimental feature experimental feature n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false Figure 3 Figure 4 Table 2 The circulating form of plasminogen was isolated from Human plasma which has a Glutamic acid residue attached to the N-termini of the plasminogen protein. Effective concentration of competitor (unlabelled Q6V4L4) required to inhibit binding by 50% (EC50) was 1.96 micro Molar. plg-q6v4l1-1 Competition binding assay reveals interaction between Plasminogen and Q6V4L1 504102 N/A 504108 unspecified role unspecified role bait bait c terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 504104 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false glu N-terminal Glu residue experimental feature experimental feature n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false Figure 3 Figure 4 Table 2 The circulating form of plasminogen was isolated from Human plasma which has a Glutamic acid residue attached to the N-termini of the plasminogen protein. Effective concentration of competitor (unlabelled Q6V4L1) required to inhibit binding by 50% (EC50) was 0.81 micro Molar. plg-q6v4k9 Competition binding assay reveals interaction between Plasminogen and Q6V4K9 504102 N/A 504104 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false glu N-terminal Glu residue experimental feature experimental feature n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 504109 unspecified role unspecified role bait bait c terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 3 Figure 4 Table 2 The circulating form of plasminogen was isolated from Human plasma which has a Glutamic acid residue attached to the N-termini of the plasminogen protein. Effective concentration of competitor (unlabelled Q6V4K9) required to inhibit binding by 50% (EC50) was 5.77 micro Molar. plg-q6v4l5-1 Ligand binding assay reveals interaction between Plasminogen and Q6V4L5 504103 N/A 504104 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false glu N-terminal Glu residue experimental feature experimental feature n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 504105 unspecified role unspecified role bait bait c terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 2C The circulating form of plasminogen was isolated from Human plasma which has a Glutamic acid residue attached to the N-termini of the plasminogen protein. plg-q6v4l9-1 Ligand binding assay reveals interaction between Plasminogen and Q6V4L9 504103 N/A 504106 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 504104 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false glu N-terminal Glu residue experimental feature experimental feature n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false Figure 2C The circulating form of plasminogen was isolated from Human plasma which has a Glutamic acid residue attached to the N-termini of the plasminogen protein. plg-q6v4l1 Ligand binding assay reveals interaction between Plasminogen and Q6V4L1 504103 N/A 504108 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 504104 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false glu N-terminal Glu residue experimental feature experimental feature n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false Figure 2C The circulating form of plasminogen was isolated from Human plasma which has a Glutamic acid residue attached to the N-termini of the plasminogen protein. plg-q6v4l4-1 Ligand binding assay reveals interaction between Plasminogen and Q6V4L4 504103 N/A 504107 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 504104 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false glu N-terminal Glu residue experimental feature experimental feature n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false Figure 2C The circulating form of plasminogen was isolated from Human plasma which has a Glutamic acid residue attached to the N-termini of the plasminogen protein.