IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sou-2006-1 Phosphatidylserine in addition to phosphatidylethanolamine is an in vitro target of the mammalian Atg8 modifiers, LC3, GABARAP, and GATE-16. in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Sou YS., Tanida I., Komatsu M., Ueno T., Kominami E. BioCreative - Critical Assessment of Information Extraction systems in Biology kominami@med.juntendo.ac.jp J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation atg7_human Ubiquitin-like modifier-activating enzyme ATG7 ATG12-activating enzyme E1 ATG7 Ubiquitin-activating enzyme E1-like protein ATG7 APG7L Autophagy-related protein 7 protein protein human Homo sapiens Human MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGTALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEALECAYDNLCQTEGVTALPYFLIKYDENMVLVSLLKHYSDFFQGQRTKITIGVYDPCNLAQYPGWPLRNFLVLAAHRWSSSFQSVEVVCFRDRTMQGARDVAHSIIFEVKLPEMAFSPDCPKAVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLLLGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADRLQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRESRWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYEREGFNFLAKVFNSSHSFLEDLTGLTLLHQETQAAEIWDMSDDETI mlp3b_human Microtubule-associated proteins 1A/1B light chain 3B MAP1LC3B MAP1ALC3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein human Homo sapiens Human MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV gbrap_human Gamma-aminobutyric acid receptor-associated protein GABA(A) receptor-associated protein MM46 GABARAP FLC3B HT004 protein protein human Homo sapiens Human MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL gbrl2_human Gamma-aminobutyric acid receptor-associated protein-like 2 GABA(A) receptor-associated protein-like 2 Golgi-associated ATPase enhancer of 16 kDa General protein transport factor p16 Ganglioside expression factor 2 MAP1 light chain 3-related protein GABARAPL2 FLC3A GEF2 protein protein human Homo sapiens Human MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF atg3_human Ubiquitin-like-conjugating enzyme ATG3 Autophagy-related protein 3 Protein PC3-96 ATG3 APG3 APG3L protein protein human Homo sapiens Human MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM atg7-map1lc3b Interaction between Atg7 and LC3 proteins 504719 N/A 504720 unspecified role unspecified role neutral component neutral component N/A 504721 unspecified role unspecified role neutral component neutral component gly required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Figure 2 A Adenosine Triphosphate (ATP) Dithiothreitol (DTT) Atg7 and LC3 interaction via a thioester bond formation atg7-gabarap Interaction between Atg7 and GABARAP proteins 504719 N/A 504720 unspecified role unspecified role neutral component neutral component N/A 504722 unspecified role unspecified role neutral component neutral component gly required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Figure 2 B Adenosine Triphosphate (ATP) Dithiothreitol (DTT) Atg7 and GABARAP interaction via a thioester bond formation. atg7-gabarapl2 Interaction between Atg7 and GABARAPL2 proteins 504719 N/A 504720 unspecified role unspecified role neutral component neutral component N/A 504723 unspecified role unspecified role neutral component neutral component gly required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Figure 2 C Adenosine Triphosphate (ATP) Dithiothreitol (DTT) Atg7 protein interaction with GABARAPL2 protein was proposed to be va thioester bond formation. atg3-map1lc3b Interaction between Atg3 and LC3 proteins 504719 N/A 504721 unspecified role unspecified role neutral component neutral component gly sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 504724 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false Figure 3 A Adenosine Triphosphate (ATP) Dithiothreitol (DTT) Atg3 and LC3 interaction via a thioester bond formation atg3-gabarap Interaction between Atg3 and GABARAP proteins 504719 N/A 504724 unspecified role unspecified role neutral component neutral component N/A 504722 unspecified role unspecified role neutral component neutral component gly required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Figure 3 B Adenosine Triphosphate (ATP) Dithiothreitol (DTT) Atg3 and GABARAP interaction via a thioester bond formation. atg3-gabarapl2 Interaction between Atg3 and GABARAPL2 proteins 504719 N/A 504723 unspecified role unspecified role neutral component neutral component gly required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 504724 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false Figure 3 C Adenosine Triphosphate (ATP) Dithiothreitol (DTT) Atg3 protein interaction with GABARAPL2 protein was proposed to be va thioester bond formation.