IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sgarra-2006-3 The AT-hook of the chromatin architectural transcription factor high mobility group A1a is arginine-methylated by protein arginine methyltransferase 6. in vitro In vitro radiolabeled methyl methyltransferase radiometric assay radiolabeled methyl predetermined predetermined participant predetermined Sgarra R., Lee J., Tessari MA., Altamura S., Spolaore B., Giancotti V., Bedford MT., Manfioletti G. BioCreative - Critical Assessment of Information Extraction systems in Biology 3, 4 manfiole@units.it J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation sgarra-2006-2 The AT-hook of the chromatin architectural transcription factor high mobility group A1a is arginine-methylated by protein arginine methyltransferase 6. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Sgarra R., Lee J., Tessari MA., Altamura S., Spolaore B., Giancotti V., Bedford MT., Manfioletti G. BioCreative - Critical Assessment of Information Extraction systems in Biology A series of HMG proteins or deletion constructs obtained from HEK 293 cells were run on the gel and blot overlay was performed with cell lysates obtained from HEK293 cells expressing HA tagged PRMT6 or NPM constructs. These were then visualised with anti HA antibodies. 3, 4 manfiole@units.it J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation sgarra-2006-1 The AT-hook of the chromatin architectural transcription factor high mobility group A1a is arginine-methylated by protein arginine methyltransferase 6. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sgarra R., Lee J., Tessari MA., Altamura S., Spolaore B., Giancotti V., Bedford MT., Manfioletti G. BioCreative - Critical Assessment of Information Extraction systems in Biology 3, 4 manfiole@units.it J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation sgarra-2006-4 The AT-hook of the chromatin architectural transcription factor high mobility group A1a is arginine-methylated by protein arginine methyltransferase 6. in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as ms participant Identification by mass spectrometry ms participant Sgarra R., Lee J., Tessari MA., Altamura S., Spolaore B., Giancotti V., Bedford MT., Manfioletti G. BioCreative - Critical Assessment of Information Extraction systems in Biology 3, 4 manfiole@units.it J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation hmga2_human High mobility group protein HMGI-C High mobility group AT-hook protein 2 HMGA2 HMGIC protein protein human Homo sapiens Human MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED anm1_human Protein arginine N-methyltransferase 1 PRMT1 Interferon receptor 1-bound protein 4 Histone-arginine N-methyltransferase PRMT1 HMT2 HRMT1L2 IR1B4 protein protein human Homo sapiens Human MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR s-adenosyl-l-methionine S adenosyl Methionine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) hmga2_mouse High mobility group protein HMGI-C High mobility group AT-hook protein 2 Hmga2 Hmgic protein protein mouse Mus musculus Mouse MSARGEGAGQPSTSAQGQPAAPVPQKRGRGRPRKQQQEPTCEPSPKRPRGRPKGSKNKSPSKAAQKKAETIGEKRPRGRPRKWPQQVVQKKPAQETEETSSQESAEED anm6_human Protein arginine N-methyltransferase 6 Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6 PRMT6 HRMT1L6 Histone-arginine N-methyltransferase PRMT6 protein protein human Homo sapiens Human MSQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQMLEWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAMED p17095-2 High mobility group protein HMG-I/HMG-Y HMGA1a Hmga1 Hmgi Hmgiy High mobility group AT-hook protein 1 protein protein mouse Mus musculus Mouse MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKVTTAPGRKPRGRPKKLEKEEEEGISQESSEEEQ p17095-1 High mobility group protein HMG-I/HMG-Y HMGA1b HMGI-E Hmga1 Hmgi Hmgiy High mobility group AT-hook protein 1 protein protein mouse Mus musculus Mouse MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKVTTAPGRKPRGRPKKLEKEEEEGISQESSEEEQ p17096-1 High mobility group protein HMG-I/HMG-Y HMGA1a HMGA1 HMGIY High mobility group AT-hook protein 1 High mobility group protein R protein protein human Homo sapiens Human MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ p17096-2 High mobility group protein HMG-I/HMG-Y HMGA1b HMGA1 HMGIY High mobility group AT-hook protein 1 High mobility group protein R protein protein human Homo sapiens Human MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ Contains a phosphothreonine at position 67. Contains a phosphothreonine at position 42. hrmt1l2-hmga2 361567 N/A 361571 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 361572 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 361573 unspecified role unspecified role ancillary ancillary physical association physical association false false false Interaction performed in the presence of H3 labelled SAM CHEBI:15414 hrmt1l2-hmga2-1 361567 N/A 361574 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 361572 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 361573 unspecified role unspecified role ancillary ancillary physical association physical association false false false Interaction performed in the presence of H3 labelled SAM CHEBI:15414 hrmt1l6-hmgiy-3 361567 N/A 361575 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 361576 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 361573 unspecified role unspecified role ancillary ancillary physical association physical association false false false Interaction carried out in the presence of H3 Labelled SAM CHEBI:15414 hrmt1l6-hmgiy-4 361567 N/A 361577 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 361575 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 361573 unspecified role unspecified role ancillary ancillary physical association physical association false false false Interaction carried out in the presence of H3 Labelled SAM CHEBI:15414 hrmt1l6-hmgiy-5 361567 N/A 361578 enzyme target enzyme target substrate substrate unspecified role unspecified role P17096-1:p.[Arg58Ala;Arg60Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false at hook 2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 361575 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 361573 unspecified role unspecified role ancillary ancillary physical association physical association false false false Interaction carried out in the presence of H3 Labelled SAM CHEBI:15414 hrmt1l6-hmg2a 361567 N/A 361575 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 361571 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 361573 unspecified role unspecified role ancillary ancillary physical association physical association false false false Interaction carried out in the presence of H3 Labelled SAM CHEBI:15414 hrmt1l6-hmg2a-1 361567 N/A 361574 enzyme target enzyme target substrate substrate unspecified role unspecified role N/A 361575 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 361573 unspecified role unspecified role ancillary ancillary physical association physical association false false false Interaction carried out in the presence of H3 Labelled SAM CHEBI:15414 hrmt1l6-hmgiy-1 361568 N/A 361578 unspecified role unspecified role bait bait at hook 2 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 361575 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false Hek293 Cell lysates and various deletion mutants were used to obtain the results. hrmt1l6-hmgiy-2 361568 N/A 361575 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 361579 unspecified role unspecified role bait bait physical association physical association false false false HEK 293 lysates were used for WT HMGA1b interaction hrmt1l6-hmga2 361568 N/A 361571 unspecified role unspecified role bait bait N/A 361575 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false HEK 293 lysates were used for WT HMGA2 interaction hrmt1l6-hmgiy 361569 N/A 361578 unspecified role unspecified role bait bait N/A 361575 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false hrmt1l6-hmgiy-6 361570 N/A 361575 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 361578 enzyme target enzyme target substrate substrate unspecified role unspecified role at hook 2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 361573 unspecified role unspecified role ancillary ancillary physical association physical association false false false Interaction carried out in the presence of H3 Labelled SAM CHEBI:15414 Time course of methyltransferase activity indicates the presence of monomethylarginines within 4 hours and dimethylarginine over 32 hours. Mehtylation occurs on R57 and R59 of HMGI/Y.