IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lane-2006-1 Molecular basis of the interaction between the flagellar export proteins FliI and FliH from Helicobacter pylori. in vitro In vitro cosedimentation cosedimentation predetermined predetermined participant predetermined Lane MC., O'Toole PW., Moore SA. BioCreative - Critical Assessment of Information Extraction systems in Biology Co-purified on Superdex 75 and Superdex 200 columns stan.moore@usask.ca J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation lane-2006-2 Molecular basis of the interaction between the flagellar export proteins FliI and FliH from Helicobacter pylori. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lane MC., O'Toole PW., Moore SA. BioCreative - Critical Assessment of Information Extraction systems in Biology Co-purified on Superdex 75 and Superdex 200 columns stan.moore@usask.ca J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation flii_helpy Flagellum-specific ATP synthase fliI HP_1420 protein protein helpy Helicobacter pylori Campylobacter pylori MPLKSLKNRLNQHFDLSPRYGSVKKIMPNIVYADGFNPSVGDVVKIEKSDGSECVGMVVVAEKEQFGFTPFNFIEGARAGDKVLFLKEGLNFPVGRNLLGRVLNPLGQVIDNKGALDYERLAPVITTPIAPLKRGLIDEIFSVGVKSIDGLLTCGKGQKLGIFAGSGVGKSTLMGMITRGCLAPIKVIALIGERGREIPEFIEKNLKGDLSSCVLVVATSDDSPLMRKYGAFCAMSVAEYFKNQGLDVLFIMDSVTRFAMAQREIGLALGEPPTSKGYPPSALSLLPQLMERAGKEENKGSITAFFSVLVEGDDLSDPIADQTRSILDGHIVLSRELTDYGIYPPINILNSASRVAKDIISESQNLCARKFRRLYALLKENEMLIRIGSYQMGNDKELDEAIKKKALMEQFLAQDENALQPFETSFQQLEEILR o25120_helpy HP_0353 protein protein helpy Helicobacter pylori Campylobacter pylori MSLNSRKNLIQKDHLNKHDIQKYEFKNMANLPPKTNPNSASLETPNLEEPLEKKAIENDLIDCLLKKTDELSSHLVKLQMQFEKAQEESKVLIENAKNDGYKIGFKEGEEKMRNELTHSVNEEKNQLLHAITTLDEKMKKSEDHLMALEKELSAIAIDIAKEVILKEVEDNSQKVALALAEELLKNVLDATDIHLKVNPLDYPYLNERLQNASKIKLESNEAISKGGVMITSSNGSLDGNLMERFKTLKESVLENFKV flii-flii-1 Oligermerisation of FliI demonstrated by gel filtration 491042 N/A 491044 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) Stoichiometry: 3.0 direct interaction direct interaction false false false 2, 6B flih-flih-2 Oligermerisation of FliH demonstrated by gel filtration 491042 N/A 491045 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) Stoichiometry: 2.0 direct interaction direct interaction false false false 2, 6B FliH can exist as trimers, or more commonly as dimers, under these experimental conditions. flii-flih-3 Interaction between FliI between FliH demonstrated by gel filtration 491042 N/A 491044 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false O07025:p.Leu3Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) Stoichiometry: 4.0 N/A 491045 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) Stoichiometry: 3.0 491058 491054 direct interaction direct interaction false false false 6, 7 The molecular weight of the complex is estimated at 1.3 x 10EXP6 D. flii-flih-1 Interaction between FliH and FliI demonstrated by GST pulldown 491043 N/A 491045 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 491044 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) 491063 491061 direct interaction direct interaction false false false 4 flii-flih-2 Interaction between FliH and FliI demonstrated by GST pulldown 491043 N/A 491044 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false O07025:p.Leu3Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O07025:p.Leu6Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false O07025:p.Leu10Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O07025:p.Leu6Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O07025:p.Arg9Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 491045 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 5