IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kim-2006a-2 Interaction of SPIN90 with the Arp2/3 complex mediates lamellipodia and actin comet tail formation. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kim DJ., Kim SH., Lim CS., Choi KY., Park CS., Sung BH., Yeo MG., Chang S., Kim JK., Song WK. BioCreative - Critical Assessment of Information Extraction systems in Biology It is assumed that GST-SPIN90 pulls down the Arp2/3 complex (Cytoskeleton Inc, Denver, CO) which consists of 7 protein subunits, all present in approximately equal stoichiometry. The protein complex used in this experiment has been purified from bovine brain. Only one protein from this complex is identifed by Western blot. wksong@gist.ac.kr J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation kim-2006a-1 Interaction of SPIN90 with the Arp2/3 complex mediates lamellipodia and actin comet tail formation. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim DJ., Kim SH., Lim CS., Choi KY., Park CS., Sung BH., Yeo MG., Chang S., Kim JK., Song WK. BioCreative - Critical Assessment of Information Extraction systems in Biology wksong@gist.ac.kr J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation kim-2006a-3 Interaction of SPIN90 with the Arp2/3 complex mediates lamellipodia and actin comet tail formation. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Kim DJ., Kim SH., Lim CS., Choi KY., Park CS., Sung BH., Yeo MG., Chang S., Kim JK., Song WK. BioCreative - Critical Assessment of Information Extraction systems in Biology wksong@gist.ac.kr J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation spn90_human NCK-interacting protein with SH3 domain NCKIPSD AF3P21 SPIN90 54 kDa VacA-interacting protein 54 kDa vimentin-interacting protein 90 kDa SH3 protein interacting with Nck AF3p21 Dia-interacting protein 1 Diaphanous protein-interacting protein SH3 adapter protein SPIN90 WASP-interacting SH3-domain protein Wiskott-Aldrich syndrome protein-interacting protein protein protein human Homo sapiens Human MYRALYAFRSAEPNALAFAAGETFLVLERSSAHWWLAARARSGETGYVPPAYLRRLQGLEQDVLQAIDRAIEAVHNTAMRDGGKYSLEQRGVLQKLIHHRKETLSRRGPSASSVAVMTSSTSDHHLDAAAARQPNGVCRAGFERQHSLPSSEHLGADGGLYQIPLPSSQIPPQPRRAAPTTPPPPVKRRDREALMASGSGGHNTMPSGGNSVSSGSSVSSTSLDTLYTSSSPSEPGSSCSPTPPPVPRRGTHTTVSQVQPPPSKASAPEPPAEEEVATGTTSASDDLEALGTLSLGTTEEKAAAEAAVPRTIGAELMELVRRNTGLSHELCRVAIGIIVGHIQASVPASSPVMEQVLLSLVEGKDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALYEDEGVIRCYLEELLHILTDADPEVCKKMCKRNEFESVLALVAYYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYSALILAMVFSMGEAVPYAHYEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLLNRGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKLRMEYLSLMHAIVRTTPYLQHRHRLPDLQAILRRILNEEETSPQCQMDRMIVREMCKEFLVLGEAPS arp3_bovin Actin-related protein 3 ACTR3 ARP3 Actin-like protein 3 Actin-2 protein protein bovin Bos taurus (Bovine) Bovine MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS wasl_human Neural Wiskott-Aldrich syndrome protein WASL protein protein human Homo sapiens Human MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDDEEDFEDDDEWED arp3_cerae_protein African green monkey Arp3 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt spin90_cerae_protein African green monkey SPIN90 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt spin90-arp3-2 Interaction between human SPIN90 and bovine Arp3 demonstrated by GST pulldown 491014 n/a 491017 unspecified role unspecified role bait bait a-like region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 491018 unspecified role unspecified role prey prey physical association physical association false false false 4C & D wasl-arp3-1 Interaction between WASL and Arp3 demonstrated by GST pulldown 491014 N/A 491018 unspecified role unspecified role prey prey N/A 491019 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false vca region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range false physical association physical association false false false Positive control Exact position of VCA domain of WASL (N-WASP) not given, and have been derived for the SUPERFAMILY domain boundaries. 4D spin90-arp3-1 Interaction between African green monkey SPIN90 and Arp3 demonstrated by coimmunoprecipitation 491015 N/A 491020 unspecified role unspecified role bait bait N/A 491021 unspecified role unspecified role prey prey physical association physical association false false false 4A spin90-arp3-3 Interaction between African green monkey SPIN90 and Arp3 demonstrated by coimmunoprecipitation 491016 N/A 491021 unspecified role unspecified role neutral component neutral component N/A 491020 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4F Platelet derived growth factor (PDGF)