IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ morita_ishi-2006-1 Shigella Spa33 is an essential C-ring component of type III secretion machinery. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Morita-Ishihara T., Ogawa M., Sagara H., Yoshida M., Katayama E., Sasakawa C. BioCreative - Critical Assessment of Information Extraction systems in Biology sasakawa@ims.u-tokyo.ac.jp J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation q6xvw5_shifl Surface presentation of antigens protein SpaO spa33 protein protein shifl Shigella flexneri MLRIKHFDANEKLQILYAKQLCERFSIQTFKNKFTGSESLVTLTSVCGDWVIRIDTLSFLKKKYEVFSGFSTQESLLHLSKCVFIESSSVFSIPELSDKITFRITNEIQYATTGSHLCCFSSSLGIIYFDKMPVLRNQVSLDLLHHLLEFCLGSSNVRLATLKRIRTGDIIIVQKLYNLLLCNQVIIGDYIVNDNNEAKINLSESNGESDHTEVSLALFNYDDINVKVDFILLEKKMTINELKMYVENELFKFPDDIVKHVNIKVNGSLVGHGELVSIEDGYGIEISSWMVKE q6xvx6_shifl mxiN protein protein shifl Shigella flexneri MKVCNMQKGTLPVSRHHAYDGVVIKRIEKELCKTIKDRDTESKKKAICVIKDATKKAESLRIDAVCDGYQIGIQTAFEHIIDYICEWKLKQNENRRNIEDYITSLLSENLHDERIISTLLEQWLSSLRNTVTELKVVLPKCNLALRKKLELDLHKYRSDVKIILKYSEGNNYIFCSGNQVVEFSPQDVISGVKIELAEKLTKNDKKYFKELAHKKLRQIAEDLLKENPVND q6xvx7_shifl mxiK protein protein shifl Shigella flexneri MIRMDGIYKKYLSIIFDPAFYINRNRLNLPSELLENGVIRSEINNLIINKYDLNCDIEPLSGVTAMFVANWNLLPAVAYFIGSQESRLINHSEMVISYYGGKISKQGEAAIRSGFWHLIEWKENISVGIYERINLLFNPIALEGNYTPVERNLSRLNEGMQYAKRHFTGIQTSCL span_shifl Surface presentation of antigens protein SpaN spaN spa32 CP0151 Spa32 protein protein protein shifl Shigella flexneri MALDNINLNFSSDKQIEKCEKLSSIDNIDSLVLKKKRKVEIPEYSLIASNYFTIDKHFEHKHDKGEIYSGIKNAFELRNERATYSDIPESMAIKENILIPDQDIKAREKINIGDMRGIFSYNKSGNADKNFERSHTSSVNPDNLLESDNRNGQIGLKNHSLSIDKNIADIISLLNGSVAKSFELPVMNKNTADITPSMSLQEKSIVENDKNVFQKNSEMTYHFKQWGAGHSVSISVESGSFVLKPSDQFVGNKLDLILKQDAEGNYRFDSSQHNKGNKNNSTGYNEQSEEEC q6xvw8_shifl Protein-secreting ATPase spa47 protein protein shifl Shigella flexneri MSYIKLLTQLSFPNRISGPILETSLSDVSIGEICNIQAGIESNEIIARAQVVGFHDEKTILSLIGNSRGLSRQTLIKPTAQFLHTQVGRGLLGAVVNPLGEVTDKFAVTDNSEILYRPVDNAPPLYSERAAIEKPFLTGVKVIDSLLTCGEGQRMGIFASAGCGKTFLMNMLIEHSGADIYVIGLIGERGREVTETVDYLKNSEKKSRCVLVYATSDYSSVDRCNAAYIATAIAEFFRTEGHKVALFIDSLTRYARALRDVALAAGESPARRGYPVSVFDSLPRLLERPGKLKAGGSITAFYTVLLEDDDFADPLAEEVRSILDGHIYLSRNLAQKGQFPAIDSLKSISRVFTQVVDEKHRIMATAFRELLSEIEELRTIIDFGEYKPGENASQDKIYNKISVVESFLKQDYRLGFTYEQTMELLGETIR mxig_shifl Protein MxiG mxiG CP0136 protein protein shifl Shigella flexneri MSEAKNSNLAPFRLLVKLTNGVGDEFPLYYGNNLIVLGRTIETLEFGNDNFPENIIPVTDSKSDGIIYLTISKDNICQFSDEKGEQIDINSQFNSFEYDGISFHLKNMREDKSRGHILNGMYKNHSVFFFFAVIVVLIIIFSLSLKKDEVKEIAEIIDDKRYGIVNTGQCNYILAETQNDAVWASVALNKTGFTKCRYILVSNKEINRIQQYINQRFPFINLYVLNLVSDKAELLVFLSKERNSSKDTELDKLKNALIVEFPYIKNIKFNYLSDHNARGDAKGIFTKVNVQYKEICENNKVTYSVREELTDEKLELINRLISEHKNIYGDQYIEFSVLLIDDDFKGKSYLNSKDSYVMLNDKHWFFLDKNK q6xvx8_shifl Lipoprotein mxiJ protein protein shifl Shigella flexneri MIRYKCFILFLLLMLIGCEQREELISNLSQRQANEIISVLERHNITARKVDGGKQGISVQVEKGTFASAVDLMRMYDLPNPERVDISQMFPTDSLVSSPRAEKARLYSAIEQRLEQSLVSIGGVISAKIHVSYDLEEKNISSKPMHISVIAIYDSPKESELLVSNIKRFLKNTFSDVKYENISVILTPKEEYVYTNVQPVKEIKSEFLTNEVIYVFLGMAVLVVILLVWAFKTGWFKRNKI q3ytn9_shiss mxiN SSON_P103 protein protein shiss Shigella sonnei (strain Ss046) MKVCNMQKGTLPVSRHHAYDGVVIKRIEKELCKTIKDRDTESKKKAICVIKDATKKAESLRIDAVCDGYQIGIQTAFEHIIDYICEWKLKQNENRRNIEDYITSLLSENLHDERIISTLLEQWLSSLRNTVTELKVVLPKCNLALRKKLELDLHKYRSDVKIILKYSEGNNYIFCSGNQVVEFSPQDVISGVKIELAEKLTKNDKKYFKELAHKKLRQIAEDLLKENPVND vira_shifl Cysteine protease-like VirA virA Effector protein VirA pWR501_0191 CP0181 protein protein shifl Shigella flexneri MQTSNITNHERNDSSWMSTVKSTTEVSWNKLSFCDILLKIITFGIYSPHETLAEKHSEKKLMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKGICSVFYLDGDKIQSTQLSSKEYNNLLSSLPPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAINCCTSIIPNDDYFHVKDTDFNSVWHDIYRDIRASDSNSTKIYFNNIEIPLKLIADLINELGINEFIDSKKELQMLSYNQVNKIINSNFPQQDLCFQTEKLLFTSLFQDPAFISALTSAFWQSLHITSSSVEHIYAQIMSENIENRLNFMPEQRVINNCGHIIKINAVVPKNDTAISASGGRAYEVSSSILPSHITCNGVGINKIETSYLVHAGTLPSSEGLRNAIPPESRQVSFAIISPDV icsb_shifl Virulence protein IcsB icsB CP0132 protein protein shifl Shigella flexneri MSLKISNFIDASNTKGPIRVEDTEHGPILIAQKFNLKDLFFRTLSTINAKINSQILNEQLKNYRLENQKSLLLFLNTLASEKSAESAFAAYEAAKNSIQHSFTGRDIKLMLNTAERFHGIGTAKNLERHLVFRCWGNRGITHLGHTSISIKNNLLQEPTHTYLSWYPGGNVTKDTEINYLFEKRSGYSVDTYKQDKLNMISEQTAERLDAGQEVRNLLNSKQDQNNNKKIFFPRANQKKDPYGYWGVSADKVYIPLSGDNKTKDGKISHNLFGLDETNMSKFICKKKADAFRQLANYKLISKSENCAGMALNVLKAGNSEIYFPLPDVKLVATPNDVYAYANKVRQRIESLNQSYNEIMKYIESDFDLSRLTQLRRSYLKSFNKINLIHTPKTFKPLSISLYKHPTENVSSEDFDAVINACHSYLVKSAPSNMTRVLNELKTEATDKKEEIIEKSIKIIDYYNSLKSPDLGTKLYIHDLLQINKLLLNNSHSNI q6xvz0_shifl ipaC protein protein shifl Shigella flexneri MEIQNTKSAPILYTDISTKQTQSSSETQKSQNYQQLAAHIPLNVGKNPVLTTTLNDDQLLKLSEQVQHDSEIIARLTDKKMKDLSEMSHTITPENTLDISSLSSNAVSLIISVAVLLSALRTAETRLGSQLSLIAFDATKSAAENIVRQGLAALSSSITGAVTQVGITGIGAKKTHSGISEQKGALRKNLATAQSLEKELAGSKLGLNKQIDTNITSPQTNSSTKILGKNKLAPDNISLSTEHKTSLSSPDISLQDKIDTQRRAYELNTLSAQQKQNIGRATMETSAVAGNISTSGGRYTSALEEEEQLISQASSKQAEEASQVSKEASQATNQLIQKLLNIIDNINQSRNSTASQIAGNIRA q6xvy7_shifl ipgB1 protein protein shifl Shigella flexneri MQILNKILPQVEFAIPRPSFDSLSHNKLVKKILSVFNLKQRFPQKNFGCPVNINKIRDSVIDKIKDSNSGNQLFCWMSQERTSYVSSMINRSIDEMAIHNGVVLTSDNKKNIFAAIEKKFPDIKLDEKSAQTSISHTALNEIASSGLRAKILKRYSSDMDLFNTQMKDLTNLVSSSVYDKIFNESTKVLQIEISAEVLKAVYRQSNTN q56021_saltp Surface presentation of antigens protein SpaO spaO protein protein saltp Salmonella typhisuis MSLRVRQIDRREWLLAQTATECQRHGQEATLEYPTRQGMWVRLSDAEKRWSAWIQPGDWLEHVSPALAGAAVSAGAEHLVVPWLAATERPFELPVPHLSCRRLCVENPVPGSALPEGKLLHIMSDRGGLWFEHLPELPAVGGGRPKMLRWPLRFVIGSSDTQCSLLGRIGIGDVLLIRTSRAEVYCYAKKLGHFNRVEGGIIVETLDIQHIEEENNTTETAETLPGLNQLPVKLEFVLYRKNVTLAELEVMGQQQLLSLPTNAELNVEIMANGVLLGNGELVQMNDTLGVEIHEWLSESGNGE spa33-mxin GST pull down assay reveals interaction between Spa33 protein and MxiN protein 496237 N/A 496238 unspecified role unspecified role prey prey shifl Shigella flexneri N/A 496239 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 3A spa33-mxik GST pull down assay reveals interaction between Spa33 protein and MxiK protein 496237 N/A 496238 unspecified role unspecified role prey prey shifl Shigella flexneri N/A 496240 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 3A spa33-spa32 GST pull down assay reveals interaction between Spa33 protein and Spa32 protein 496237 N/A 496241 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 496238 unspecified role unspecified role prey prey shifl Shigella flexneri physical association physical association false false false Figure 3A spa33-spa47 GST pull down assay reveals interaction between Spa33 protein and Spa47 protein 496237 N/A 496242 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 496238 unspecified role unspecified role prey prey shifl Shigella flexneri physical association physical association false false false Figure 3A spa33-mxig GST pull down assay reveals interaction between Spa33 protein and MxiG protein 496237 N/A 496243 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 496238 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false shifl Shigella flexneri physical association physical association false false false Figure 2D spa33-mxij GST pull down assay reveals interaction between Spa33 protein and MxiJ protein 496237 N/A 496244 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 496238 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false shifl Shigella flexneri physical association physical association false false false Figure 2D mxin-spa33 FLAG pull down assay reveals interaction between Spa33 protein and MxiN protein 496237 N/A 496245 unspecified role unspecified role prey prey shifl Shigella flexneri N/A 496238 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 3B spa32-spa33-1 GST pull down assay reveals interaction between Spa33 protein and Spa32 protein 496237 N/A 496238 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 496241 unspecified role unspecified role prey prey shifl Shigella flexneri physical association physical association false false false Figure 3B spa47-spa33 GST pull down assay reveals interaction between Spa33 protein and Spa47 protein 496237 N/A 496242 unspecified role unspecified role prey prey shifl Shigella flexneri N/A 496238 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 3B spa33-spa47-1 GST pull down assay reveals interaction between Spa33 protein and Spa47 protein 496237 N/A 496242 unspecified role unspecified role prey prey shifl Shigella flexneri N/A 496238 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 3C spa33-spa32-1 GST pull down assay reveals interaction between Spa33 protein and Spa32 protein 496237 N/A 496238 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 496241 unspecified role unspecified role prey prey shifl Shigella flexneri physical association physical association false false false Figure 3C spa33-mxin-1 GST pull down assay reveals interaction between Spa33 protein and MxiN protein 496237 N/A 496239 unspecified role unspecified role prey prey shifl Shigella flexneri N/A 496238 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q6XVW5:p.Gly273Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q6XVW5:p.Ile286Gln mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q6XVW5:p.Leu242Gln mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 3C and Figure 4D vira-spa33 GST pull down assay reveals interaction between VirA protein Spa33 protein 496237 N/A 496246 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 496238 unspecified role unspecified role prey prey shifl Shigella flexneri physical association physical association false false false Figure 3D icsb-spa33 GST pull down assay reveals interaction between IscB protein Spa33 protein 496237 N/A 496238 unspecified role unspecified role prey prey shifl Shigella flexneri N/A 496247 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 3D ipac-spa33 GST pull down assay reveals interaction between IpaC protein Spa33 protein 496237 N/A 496238 unspecified role unspecified role prey prey shifl Shigella flexneri N/A 496248 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 3D ipgb1-spa33 GST pull down assay reveals interaction between IpgB1 protein Spa33 protein 496237 N/A 496249 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 496238 unspecified role unspecified role prey prey shifl Shigella flexneri physical association physical association false false false Figure 3D mxik-spao GST pull down assay reveals interaction between MxiK protein and SpaO protein 496237 N/A 496250 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 496240 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 5A mxin-spao GST pull down assay reveals interaction between MxiN protein and SpaO protein 496237 N/A 496250 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 496239 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 5A spa32-spao GST pull down assay reveals interaction between Spa32 protein and SpaO protein 496237 N/A 496250 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 496241 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 5A spa47-spao GST pull down assay reveals interaction between Spa47 protein and SpaO 496237 N/A 496250 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 496242 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 5A mxig-spao GST pull down assay reveals interaction between MxiG protein and SpaO protein 496237 N/A 496250 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 496243 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 5A mxij-spao GST pull down assay reveals interaction between MxiJ protein and SpaO protein 496237 N/A 496244 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 496250 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 5A