UniProt UniProt http://www.uniprot.org mizumura-1999-1 Stable association of 70-kDa heat shock protein induces latent multisite specificity of a unisite-specific endonuclease in yeast mitochondria. in vitro In vitro pull down pull down monoclonal western monoclonal antibody western blot monoclonal western Mizumura H., Shibata T., Morishima N. BioCreative - Critical Assessment of Information Extraction systems in Biology Binding reaction was done with SSC1 GST-fusion protein and purified ENS2 protein. morishim@postman.riken.go.jp J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation mizumura-1999-2 Stable association of 70-kDa heat shock protein induces latent multisite specificity of a unisite-specific endonuclease in yeast mitochondria. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Mizumura H., Shibata T., Morishima N. BioCreative - Critical Assessment of Information Extraction systems in Biology Binding reaction was done with SSC1 GST-fusion protein and purified ENS2 protein. morishim@postman.riken.go.jp J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation ens2_yeasx Endonuclease SceI small subunit ENS2 RF3 Endo.SceI 50 kDa subunit Maturase-like RF3 protein protein protein yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast MKKQNLNSILLMYINYIINYFNNIHKNQLKKDWIMEYEYMYKFLMNNMTCFIKWDNNKILLLLDMYYNVLYNYHKQRTPMSNKRLMNSKNIMDYKLLYTYFYILNKMKMEMDNYNNNNNNISLKYNELLKNIMNNLNYKTSNIETNLSNNFYLMDKYLINKYMKYLDMLNMIPNNYMFNNINYKGKLNIKTVLDLNNNEFYDYLSGLIEGDGYIGPGGITITNHANDVLNTIFINKRIKNSILVEKWMDTLKDNPYFVNAFSINIKTNLAKEKIFTNIYNKLYSDYKINQINNHIPYYNYLKINNKLPIKNIMDIKNNYWLAGFTAADGSFLSSMYNPKDTLLFKNMRPSYVISQVETRKELIYLIQESFDLSISNVKKVGNRKLKDFKLFTRTTDELMKFIYYFDKFLPLHDNKQFNYIKFRFNTFIKSYNWNNRVFGLVLSEYINNIKIDNYDYYYYNKYINMHNARKPKGYIK hsp77_yeast Import motor subunit, mitochondrial ENS1 SSC1 YJR045C J1639 mtHSP70 Endonuclease SceI 75 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MLAAKNILNRSSLSSSFRIATRLQSTKVQGSVIGIDLGTTNSAVAIMEGKVPKIIENAEGSRTTPSVVAFTKEGERLVGIPAKRQAVVNPENTLFATKRLIGRRFEDAEVQRDIKQVPYKIVKHSNGDAWVEARGQTYSPAQIGGFVLNKMKETAEAYLGKPVKNAVVTVPAYFNDSQRQATKDAGQIVGLNVLRVVNEPTAAALAYGLEKSDSKVVAVFDLGGGTFDISILDIDNGVFEVKSTNGDTHLGGEDFDIYLLREIVSRFKTETGIDLENDRMAIQRIREAAEKAKIELSSTVSTEINLPFITADASGPKHINMKFSRAQFETLTAPLVKRTVDPVKKALKDAGLSTSDISEVLLVGGMSRMPKVVETVKSLFGKDPSKAVNPDEAVAIGAAVQGAVLSGEVTDVLLLDVTPLSLGIETLGGVFTRLIPRNTTIPTKKSQIFSTAAAGQTSVEIRVFQGERELVRDNKLIGNFTLAGIPPAPKGVPQIEVTFDIDADGIINVSARDKATNKDSSITVAGSSGLSENEIEQMVNDAEKFKSQDEARKQAIETANKADQLANDTENSLKEFEGKVDKAEAQKVRDQITSLKELVARVQGGEEVNAEELKTKTEELQTSSMKLFEQLYKNDSNNNNNNNGNNAESGETKQ This sequence has been withdrawn from Uniprot. 1E5672E76FCE24AC ssc1-ens2-1 370255 N/A 370257 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 370258 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false SSC1 N-terminal ATP-ase domain was found to be sufficient for the interaction but the exact range was not specified. Has multi-site specific endonuclease activity. 5 ssc1-ens2-2 370256 N/A 370257 unspecified role unspecified role neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 370258 unspecified role unspecified role neutral component neutral component physical association physical association false false false 2 The elution profile suggested a SSC1:ENS2 dimer. Only the fraction containing the dimer showed endonuclease activity.