IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hsu-1998-1 BOD (Bcl-2-related ovarian death gene) is an ovarian BH3 domain-containing proapoptotic Bcl-2 protein capable of dimerization with diverse antiapoptotic Bcl-2 members. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hsu SY., Lin P., Hsueh AJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Mol. Endocrinol. (0888-8809) 1998 mcl1_rat Induced myeloid leukemia cell differentiation protein Mcl-1 homolog Mcl1 protein protein rat Rattus norvegicus (Rat) Rat MFGLRRNAVIGLNLYCGGASLGAGGGSPAGTRLAAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLLKSPGLLAVPPEEMAASAAAIMSPEEELDGCEPEVLSKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEDDELYRQSLEIISRYLREQATGSKDAKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSFSRVMTHVFKDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR b2l11_rat Bcl-2-like protein 11 Bcl2l11 Bim Bod Bcl2-interacting mediator of cell death Bcl-2-related ovarian death protein protein protein rat Rattus norvegicus (Rat) Rat MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH bcl2_rat Apoptosis regulator Bcl-2 Bcl2 Bcl-2 protein protein rat Rattus norvegicus (Rat) Rat MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK b2cl1_rat Bcl-2-like protein 1 Bcl2l1 Bclx Blc2l Apoptosis regulator Bcl-X protein protein rat Rattus norvegicus (Rat) Rat MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK o88996_rat Bcl2l2 bcl-w rCG_23437 protein protein rat Rattus norvegicus (Rat) Rat MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK q925a9_rat Bcl2a1 Bcl2a1d protein protein rat Rattus norvegicus (Rat) Rat MTDCEFMYIHSLAENYLQYVLQVPAFESAPSKTSRVLQRVAFSVQKEVEKNLKPYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIGLDVDTYKQVSSFVAEFIMNNTGEWIQQNGGWEDGFTKKFEPKSGWLTFLQMTGKIWEMLFLLKQHY mcl_1-bcl2l11-1 Interaction detected by Y2H. 16095 N/A 16096 unspecified role unspecified role bait bait N/A 16097 unspecified role unspecified role prey prey physical association physical association false false false bcl2l11-mcl_1 Interaction detected by Y2H. 16095 N/A 16097 unspecified role unspecified role bait bait N/A 16096 unspecified role unspecified role prey prey physical association physical association false false false bcl2l11-bcl2-1 Interaction detected by Y2H. 16095 N/A 16098 unspecified role unspecified role prey prey N/A 16097 unspecified role unspecified role bait bait physical association physical association false false false bcl2l11-bcl2l1-1 Interaction detected by Y2H. 16095 N/A 16097 unspecified role unspecified role bait bait N/A 16099 unspecified role unspecified role prey prey physical association physical association false false false bcl2l11-bcl_w-1 Interaction determined by Y2H. 16095 N/A 16097 unspecified role unspecified role bait bait N/A 16100 unspecified role unspecified role prey prey physical association physical association false false false bcl2l11-bcl2a1-1 Interaction detected by Y2H. 16095 N/A 16097 unspecified role unspecified role bait bait N/A 16101 unspecified role unspecified role prey prey physical association physical association false false false