UniProt UniProt http://www.uniprot.org vavvas-1998-4 Identification of Nore1 as a potential Ras effector. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Vavvas D., Li X., Avruch J., Zhang XF. Apoptosis - Interactions involving proteins with a function related to apoptosis zhang@helix.mgh.harvard.edu activated mouse T cells J. Biol. Chem. (0021-9258) 1998 Only protein-protein interactions imex curation vavvas-1998-5 Identification of Nore1 as a potential Ras effector. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Vavvas D., Li X., Avruch J., Zhang XF. Apoptosis - Interactions involving proteins with a function related to apoptosis zhang@helix.mgh.harvard.edu J. Biol. Chem. (0021-9258) 1998 Only protein-protein interactions imex curation vavvas-1998-1 Identification of Nore1 as a potential Ras effector. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Vavvas D., Li X., Avruch J., Zhang XF. Apoptosis - Interactions involving proteins with a function related to apoptosis zhang@helix.mgh.harvard.edu J. Biol. Chem. (0021-9258) 1998 Only protein-protein interactions imex curation vavvas-1998-2 Identification of Nore1 as a potential Ras effector. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Vavvas D., Li X., Avruch J., Zhang XF. Apoptosis - Interactions involving proteins with a function related to apoptosis COS7 cells have been transfected with RASSF5 and HRAS1 and stimulated with EGF or TPA. zhang@helix.mgh.harvard.edu J. Biol. Chem. (0021-9258) 1998 Only protein-protein interactions imex curation vavvas-1998-3 Identification of Nore1 as a potential Ras effector. human-kb Homo sapiens oral epithelial carcinoma kb Human oral epithelial carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Vavvas D., Li X., Avruch J., Zhang XF. Apoptosis - Interactions involving proteins with a function related to apoptosis KB cells have been stimulated with EGF. zhang@helix.mgh.harvard.edu J. Biol. Chem. (0021-9258) 1998 Only protein-protein interactions imex curation q5ebh1-1 Ras association domain-containing protein 5 Rassf5 Nore1 Rapl New ras effector 1 Regulator for cell adhesion and polarization enriched in lymphoid tissues protein protein mouse Mus musculus Mouse MASPAIGQRPYPLLLDPEPPRYLQSLGGTEPPPPARPRRCIPTALIPAAGASEDRGGRRSGRRDPEPTPRDCRHARPVRPGLQPRLRLRPGSHRPRDVRSIFEQPQDPRVLAERGEGHRFVELALRGGPGWCDLCGREVLRQALRCANCKFTCHSECRSLIQLDCRQKGGPALDRRSPESTLTPTLNQNVCKAVEETQHPPTIQEIKQKIDSYNSREKHCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNPAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADYPLYLRLLAGPDTDVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQKLEEALRESQGKPG rash_mouse GTPase HRas Hras H-Ras-1 Hras1 Transforming protein p21 c-H-ras p21ras protein protein mouse Mus musculus Mouse MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS raf1_mouse RAF proto-oncogene serine/threonine-protein kinase Raf1 Craf Proto-oncogene c-RAF Raf-1 protein protein mouse Mus musculus Mouse MEHIQGAWKTISNGFGLKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWNTDAASLIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNSTVGDSGVPAPPSFPMRRMRESVSRMPASSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLHVDSRMIEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDDNPFSFQSDVYSYGIVLYELMAGELPYAHINNRDQIIFMVGRGYASPDLSRLYKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF araf_mouse Serine/threonine-protein kinase A-Raf Araf A-raf Araf1 Proto-oncogene A-Raf protein protein mouse Mus musculus Mouse MEPPRGPPVSGAEPSRAVGTVKVYLPNKQRTVVTVREGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLFHGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQFYHSIQDLSGGSRQQEAPSNLSVNELLTPQGPSPFTQQRDQEHFSFPAPANPPLQRIRSTSTPNVHMVSTTAPMDSSLMQFTAQSFSTDAAGRGGDGAPRGSPSPASVSSGRKSPHSKLPSEQRERKSLADEKKKVKNLGYRDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKIFSNCPKAMRRLLTDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLSAARLVP rap1b_mouse Ras-related protein Rap-1b Rap1b GTP-binding protein smg p21B protein protein mouse Mus musculus Mouse MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL rasf5_mouse Ras association domain-containing protein 5 Rassf5 Nore1 Rapl New ras effector 1 Regulator for cell adhesion and polarization enriched in lymphoid tissues protein protein mouse Mus musculus Mouse MASPAIGQRPYPLLLDPEPPRYLQSLGGTEPPPPARPRRCIPTALIPAAGASEDRGGRRSGRRDPEPTPRDCRHARPVRPGLQPRLRLRPGSHRPRDVRSIFEQPQDPRVLAERGEGHRFVELALRGGPGWCDLCGREVLRQALRCANCKFTCHSECRSLIQLDCRQKGGPALDRRSPESTLTPTLNQNVCKAVEETQHPPTIQEIKQKIDSYNSREKHCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNPAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADYPLYLRLLAGPDTDVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQKLEEALRESQGKPG rash_human GTPase HRas HRAS HRAS1 Transforming protein p21 p21ras H-Ras-1 c-H-ras Ha-Ras protein protein human Homo sapiens Human MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS rasf5_human Ras association domain-containing protein 5 RAPL RASSF5 NORE1 New ras effector 1 Regulator for cell adhesion and polarization enriched in lymphoid tissues protein protein human Homo sapiens Human MAMASPAIGQRPYPLLLDPEPPRYLQSLSGPELPPPPPDRSSRLCVPAPLSTAPGAREGRSARRAARGNLEPPPRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERGEGHCFAELVLPGGPGWCDLCGREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG hras1-rassf5-1 492356 N/A 492361 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 492362 unspecified role unspecified role bait bait Q61411:p.Gly12Val constitutive active mutation mutation certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false No figure. hras1-raf1-1 492356 N/A 492362 unspecified role unspecified role bait bait Q61411:p.Gly12Val constitutive active mutation mutation certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 492363 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false No figure. hras1-araf-1 492356 N/A 492364 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 492362 unspecified role unspecified role bait bait Q61411:p.Gly12Val constitutive active mutation mutation certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false No figure. rassf5-hras1-3 492357 N/A 492361 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 492362 unspecified role unspecified role prey prey Q61411:p.[Gly12Val;Asp38Asn] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false gly12val,pro34del,asp38asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Table I rassf5-rap1b-1 492357 N/A 492365 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 492361 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Table I rassf5-hras1-1 492358 N/A 492366 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 492362 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false The activated (GTP-bound) form of Hras1 is necessary for the interaction. 3 rassf5-hras1-2 492359 N/A 492366 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 N/A 492362 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association false false false 4A Interaction is detected 5 min after stimulation with EGF and decreases afterwards. Interaction is detected 20 min after stimulation with TPA. hras1-rassf5-2 492360 N/A 492367 unspecified role unspecified role bait bait N/A 492368 unspecified role unspecified role prey prey physical association physical association false false false Interaction was detected 5, 15 and 40 min after stimulation with EGF, and decreased afterwards. 4B