IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hu-1994-1 A novel RING finger protein interacts with the cytoplasmic domain of CD40. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hu HM., O'Rourke K., Boguski MS., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis J. Biol. Chem. (0021-9258) 1994 hu-1994-2 A novel RING finger protein interacts with the cytoplasmic domain of CD40. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Hu HM., O'Rourke K., Boguski MS., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis J. Biol. Chem. (0021-9258) 1994 hu-1994-3 A novel RING finger protein interacts with the cytoplasmic domain of CD40. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hu HM., O'Rourke K., Boguski MS., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis Directed yeast-2-hybrid J. Biol. Chem. (0021-9258) 1994 traf3_human TNF receptor-associated factor 3 TRAF3 CAP1 CRAF1 CD40 receptor-associated factor 1 CD40-binding protein LMP1-associated protein 1 CAP-1 RING-type E3 ubiquitin transferase TRAF3 protein protein human Homo sapiens Human MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP tnr5_human Tumor necrosis factor receptor superfamily member 5 CD40L receptor B-cell surface antigen CD40 Bp50 CDw40 CD40 TNFRSF5 protein protein human Homo sapiens Human MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ cd40-traf3 Yeast-2-hybrid reveals interaction between the CD40 protein and the TNF receptor associated factor 3 (TRAF3) 177281 N/A 177284 unspecified role unspecified role prey prey N/A 177285 unspecified role unspecified role bait bait cytoplasmic domain cytoplasmic domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false cd40-traf3-2 GST pulldown reveals interaction between the CD40 protein and the TNF receptor associated factor 3 (TRAF3) 177282 N/A 177284 unspecified role unspecified role prey prey s35 radiolabelled 35S labelled protein radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 177285 unspecified role unspecified role bait bait cytoplasmic domain cytoplasmic domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false cd40-traf3-1 Directed yeast-2-hybrid reveals interaction between the CD40 protein and the TNF receptor associated factor 3 (TRAF3) 177283 N/A 177285 unspecified role unspecified role bait bait cytoplasmic domain cytoplasmic domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P25942:p.Thr254Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 177284 unspecified role unspecified role prey prey physical association physical association false false false The mutant CD40A ((where Thr234 was changed to an alanine) has been assumed to refer to residue 254 - which is residue 234 when the signal sequence is removed.