IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kong-2012-1 The MEKK1-MKK1/MKK2-MPK4 Kinase Cascade Negatively Regulates Immunity Mediated by a Mitogen-Activated Protein Kinase Kinase Kinase in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kong Q., Qu N., Gao M., Zhang Z., Ding X., Yang F., Li Y., Dong O.X., Chen S., Li X., Zhang Y. Apoptosis - Interactions involving proteins with a function related to apoptosis yuelin. zhang@ubc.ca Plant Cell (1040-4651) 2012 Only protein-protein interactions imex curation kong-2012-2 The MEKK1-MKK1/MKK2-MPK4 Kinase Cascade Negatively Regulates Immunity Mediated by a Mitogen-Activated Protein Kinase Kinase Kinase in Arabidopsis. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kong Q., Qu N., Gao M., Zhang Z., Ding X., Yang F., Li Y., Dong O.X., Chen S., Li X., Zhang Y. Apoptosis - Interactions involving proteins with a function related to apoptosis yuelin. zhang@ubc.ca Plant Cell (1040-4651) 2012 Only protein-protein interactions imex curation kong-2012-3 The MEKK1-MKK1/MKK2-MPK4 Kinase Cascade Negatively Regulates Immunity Mediated by a Mitogen-Activated Protein Kinase Kinase Kinase in Arabidopsis. in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Kong Q., Qu N., Gao M., Zhang Z., Ding X., Yang F., Li Y., Dong O.X., Chen S., Li X., Zhang Y. Apoptosis - Interactions involving proteins with a function related to apoptosis MPK4 was purified from wild-type or mpk4-3 mutant plants by immunoprecipitation using anti-MPK4 antibodies. Details of the mpk4_arath mpk4-3 mutation were obtained from Gao et al., 2008. yuelin. zhang@ubc.ca Plant Cell (1040-4651) 2012 Only protein-protein interactions imex curation mp3k2_arath Mitogen-activated protein kinase kinase kinase 9 MEKK2 MAPK/ERK kinase kinase 2 MAPKKK9 Protein SUPPRESSOR OF MKK1 MKK2 1 SUMM1 T15F16.3 At4g08480 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKKSSDKSPVRQHDTATQINSDAVSSSTSFTDSDSTCSFLTPSMEFPDRISFRRIDFSEAAPTGVVLPSTSSELTRSNSSENKIPNEDISVSTSSRYLVFDKILALMKKSPGRRGDKTSPARRLDRSDAVRRNIDYDAGEDSSSLLITRSLDFPNRTSFRVDGVDDGEIDRIYQYIGVSGPEDFAISSDAWKARMEHERSSSDVVNKLKSLDLDSREAGPSGGVVASSSMNHKFQGHDLSEAGSIGVVVASNFTLSESNKIENLNSLRDKEIVDGDMVENRCGIERKPTILVKSRGYLVHNDDVGVGGGIKGVRPPVLNVPRADKEVVDGGTVESKSGIEWKPTILVKSKGYLVSNDGGIKGVTSPVLNLRPTDKEVVDSGTVENRRGIKGVRPSVLKPPPVMKLPPVDLPGSSWDILTHFAPDSEIVRRPSSSSSSENGCDEEEAEDDKVEKEETGDMFIQLEDTTDEACSFTTNEGDSSSTVSNTSPICVSGGSINTSWQKGQLLRQGSFGSVYEAISEDGDFFAVKEVSLLDQGSQAQECIQQLEGEIALLSQLEHQNILRYRGTDKDGSNLYIFLELVTQGSLLELYRRYQIRDSLISLYTKQILDGLKYLHHKGFIHRDIKCATILVDANGTVKLADFGLAKVSKLNDIKSRKETLFWMAPEVINRKDNDGYRSPADIWSLGCTVLEMCTGQIPYSDLEPVEALFRIRRGTLPEVPDTLSLDARHFILKCLKLNPEERPTATELLNHPFVRRPLPSSGSGSTSPLIRR mpk4_arath Mitogen-activated protein kinase 4 MPK4 At4g01370 F2N1.1 F2N1_2-t protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAESCFGSSGDQSSSKGVATHGGSYVQYNVYGNLFEVSRKYVPPLRPIGRGAYGIVCAATNSETGEEVAIKKIGNAFDNIIDAKRTLREIKLLKHMDHENVIAVKDIIKPPQRENFNDVYIVYELMDTDLHQIIRSNQPLTDDHCRFFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKLGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGETMTREPLFPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFAARFPNMSAGAVDLLEKMLVFDPSRRITVDEALCHPYLAPLHDINEEPVCVRPFNFDFEQPTLTEENIKELIYRETVKFNPQDSV mpk4-t15f16_3 1314007 n/a 1314010 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 1314011 unspecified role unspecified role bait bait physical association physical association false false false 6a and 6b t15f16_3-mpk4 1314008 n/a 1314011 unspecified role unspecified role prey prey n/a 1314010 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 6c mpk4-t15f16_3-1 1314009 n/a 1314010 enzyme target enzyme target substrate substrate neutral component neutral component purified purified n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1314011 enzyme enzyme neutral component neutral component partially purified partially purified Q39024:p.Gly186Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress phosphorylation phosphorylation reaction phosphorylation false false false 6d