IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ o'hagan-2011-5 Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. human-sw480 Human SW480 adenocarcinoma cell line sw480 SW480- human primary colorectal adenocarcinoma cell line There is a G -> A mutation in codon 273 of the p53 gene resulting in an Arg -> His substitution and a C -> T mutation in codon 309 resulting in a Pro -> Ser substitution. http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CCL-228&Template=cellBiology chip-chip chromatin immunoprecipitation array chip-chip tag fluorescence tag visualisation by fluorescence tag fluorescence O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis It has been assumed that SW480 cells were used in Fig S4G, but this has not been confirmed. No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer o'hagan-2011-8 Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. human-sw480 Human SW480 adenocarcinoma cell line sw480 SW480- human primary colorectal adenocarcinoma cell line There is a G -> A mutation in codon 273 of the p53 gene resulting in an Arg -> His substitution and a C -> T mutation in codon 309 resulting in a Pro -> Ser substitution. http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CCL-228&Template=cellBiology ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer o'hagan-2011-7 Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis distal colon epithelial cells from Min mice, sham and ETBF treated. No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer o'hagan-2011-1 Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. human-nccit Human NCCIT-a mediastinal mixed germ cell tumor-pluripotent stem cell line. nccit Human NCCIT pluripotent stem cell line,from a mediastinal mixed germ cell tumor. http://www.lgcstandards-atcc.org/LGCAdvancedCatalogueSearch/ProductDescription/tabid/1068/Default.aspx?ATCCNum=CRL-2073&Template=cellBiology anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer o'hagan-2011-2 Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis Flag-DNMT1 (Human) has been entered, but this has not been confirmed by the authors. No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer o'hagan-2011-4 Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. human-nccit Human NCCIT-a mediastinal mixed germ cell tumor-pluripotent stem cell line. nccit Human NCCIT pluripotent stem cell line,from a mediastinal mixed germ cell tumor. http://www.lgcstandards-atcc.org/LGCAdvancedCatalogueSearch/ProductDescription/tabid/1068/Default.aspx?ATCCNum=CRL-2073&Template=cellBiology fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer o'hagan-2011-3 Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. human-nccit Human NCCIT-a mediastinal mixed germ cell tumor-pluripotent stem cell line. nccit Human NCCIT pluripotent stem cell line,from a mediastinal mixed germ cell tumor. http://www.lgcstandards-atcc.org/LGCAdvancedCatalogueSearch/ProductDescription/tabid/1068/Default.aspx?ATCCNum=CRL-2073&Template=cellBiology density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer o'hagan-2011-6 Oxidative Damage Targets Complexes Containing DNA Methyltransferases, SIRT1, and Polycomb Members to Promoter CpG Islands. mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot O'Hagan H.M., Wang W., Sen S., Destefano Shields C., Lee S.S., Zhang Y.W., Clements E.G., Cai Y., Van Neste L., Easwaran H., Casero R.A., Sears C.L., Baylin S.B. Apoptosis - Interactions involving proteins with a function related to apoptosis Multiple intestinal neoplasia (Min) mice infected with the the human commensal organism "enterotoxigenic Bacteroides fragilis" - (ETBF), which induces inflammation and tumorigenesis primarily in the distal colon- an in-vivo model of colitis. Min mice are heterozygous for loss of Adenomatous polyposis coli (Apc). No isoforms of Human EED have been entered as they cannot be unambiguously identified (UniProt states (2011):"Two variants of the PRC2 complex have been described, termed PRC3 and PRC4. Each of the three complexes may include a different complement of EED isoforms, although the precise sequences of the isoforms in each complex have not been determined.") sbaylin@jhmi.edu Cancer Cell (1535-6108) 2011 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer myc_human_gene Human c-myc gene gene gene human Homo sapiens Human sir1_human NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 SIRT1 SIR2L1 SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein human Homo sapiens Human MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS h2ax_human Histone H2AX H2AX H2AFX Histone H2A.X protein protein human Homo sapiens Human MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY dnmt1_human DNA (cytosine-5)-methyltransferase 1 CXXC9 MCMT DNA methyltransferase HsaI CXXC-type zinc finger protein 9 DNMT1 AIM DNMT protein protein human Homo sapiens Human MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRRSKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKPQEESERAKSDESIKEEDKDQDEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQKLKEEPDREARAGVQADEDEDGDEKDEKKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVMNSKTHPPKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQHKLTCFSVYCKHGHLCPIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIGFSTSFAEYILMDPSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTVPPSGLNLNRFTEDSLLRHAQFVVEQVESYDEAGDSDEQPIFLTPCMRDLIKLAGVTLGQRRAQARRQTIRHSTREKDRGPTKATTTKLVYQIFDTFFAEQIEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDMVKFGGSGRSKQACQERRCPNMAMKEADDDEEVDDNIPEMPSPKKMHQGKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVLEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRVNKFYRPENTHKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMGGPNRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEIKLPKLRTLDVFSGCGGLSEGFHQAGISDTLWAIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLVMAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD ezh2_human Histone-lysine N-methyltransferase EZH2 KMT6 Enhancer of zeste homolog 2 ENX-1 Lysine N-methyltransferase 6 EZH2 protein protein human Homo sapiens Human MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP dnm3b_human DNA (cytosine-5)-methyltransferase 3B DNMT3B DNA methyltransferase HsaIIIB protein protein human Homo sapiens Human MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEFPATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKPNNTQPVVNKSKVRRAGSRKLESRKYENKTRRRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQMASDVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRKDWNVRLQAFFTSDTGLEYEAPKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGKYVASEVCEESIAVGTVKHEGNIKYVNDVRNITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLECNPVMIDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYNRIAKLKKVQTITTKSNSIKQGKNQLFPVVMNGKEDVLWCTELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE rl13_human_gene RPL Human gene gene gene human Homo sapiens Human actb_human_gene ACTB_HUMAN_GENE/Actin B gene gene human Homo sapiens Human rl10a_human_gene RPL10A Human gene gene gene human Homo sapiens Human sfrp4_human_gene SFRP4_HUMAN_GENE gene gene human Homo sapiens Human epdr1_human_gene EPDR1_HUMAN_GENE gene gene human Homo sapiens Human epmip_human_gene EPM2AIP1_HUMAN_GENE gene gene human Homo sapiens Human mlh1_human_gene MLH1_HUMAN_GENE gene gene human Homo sapiens Human sfrp5_human_gene SFRP5_HUMAN_GENE gene gene human Homo sapiens Human timp3_human_gene TIMP3_HUMAN_GENE gene gene human Homo sapiens Human gata4_human_gene GATA4_HUMAN_GENE gene gene human Homo sapiens Human gata5_human_gene GATA5_HUMAN_GENE gene gene human Homo sapiens Human sfrp2_human_gene SFRP2_HUMAN_GENE gene gene human Homo sapiens Human myl6b_human_gene MYL6B_HUMAN_GENE gene gene human Homo sapiens Human ptn_human_gene PTN_HUMAN_GENE gene gene human Homo sapiens Human myl6_human_gene MYL6_HUMAN_GENE gene gene human Homo sapiens Human xct_human_gene XCT_HUMAN_GENE/SLC7A11 gene gene human Homo sapiens Human pkha6_human_gene PKHA6_HUMAN_GENE/PLEKHA6 gene gene human Homo sapiens Human fbn1_mouse_gene FBN1_MOUSE_GENE gene gene mouse Mus musculus Mouse ezh2_mouse Histone-lysine N-methyltransferase EZH2 Ezh2 Enx1h Enhancer of zeste homolog 2 ENX-1 protein protein mouse Mus musculus Mouse MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKTMFSSNRQKILERTETLNQEWKQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPAQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPDEREEKQKDLEDNRDDKETCPPRKFPADKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTISVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPVPTEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP dnmt1_mouse DNA (cytosine-5)-methyltransferase 1 Dnmt1 Dnmt Met1 Uim MCMT DNA methyltransferase MmuI protein protein mouse Mus musculus Mouse MPARTAPARVPALASPAGSLPDHVRRRLKDLERDGLTEKECVREKLNLLHEFLQTEIKSQLCDLETKLHKEELSEEGYLAKVKSLLNKDLSLENGTHTLTQKANGCPANGSRPTWRAEMADSNRSPRSRPKPRGPRRSKSDSDTLSVETSPSSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKRRVVDTESGAAAAVEKLEEVTAGTQLGPEEPCEQEDDNRSLRRHTRELSLRRKSKEDPDREARPETHLDEDEDGKKDKRSSRPRSQPRDPAAKRRPKEAEPEQVAPETPEDRDEDEREEKRRKTTRKKLESHTVPVQSRSERKAAQSKSVIPKINSPKCPECGQHLDDPNLKYQQHPEDAVDEPQMLTSEKLSIYDSTSTWFDTYEDSPMHRFTSFSVYCSRGHLCPVDTGLIEKNVELYFSGCAKAIHDENPSMEGGINGKNLGPINQWWLSGFDGGEKVLIGFSTAFAEYILMEPSKEYEPIFGLMQEKIYISKIVVEFLQNNPDAVYEDLINKIETTVPPSTINVNRFTEDSLLRHAQFVVSQVESYDEAKDDDETPIFLSPCMRALIHLAGVSLGQRRATRRVMGATKEKDKAPTKATTTKLVYQIFDTFFSEQIEKYDKEDKENAMKRRRCGVCEVCQQPECGKCKACKDMVKFGGTGRSKQACLKRRCPNLAVKEADDDEEADDDVSEMPSPKKLHQGKKKKQNKDRISWLGQPMKIEENRTYYQKVSIDEEMLEVGDCVSVIPDDSSKPLYLARVTALWEDKNGQMMFHAHWFCAGTDTVLGATSDPLELFLVGECENMQLSYIHSKVKVIYKAPSENWAMEGGTDPETTLPGAEDGKTYFFQLWYNQEYARFESPPKTQPTEDNKHKFCLSCIRLAELRQKEMPKVLEQIEEVDGRVYCSSITKNGVVYRLGDSVYLPPEAFTFNIKVASPVKRPKKDPVNETLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIHCGKKKGKVNEADIKLRLYKFYRPENTHRSYNGSYHTDINMLYWSDEEAVVNFSDVQGRCTVEYGEDLLESIQDYSQGGPDRFYFLEAYNSKTKNFEDPPNHARSPGNKGKGKGKGKGKGKHQVSEPKEPEAAIKLPKLRTLDVFSGCGGLSEGFHQAGISETLWAIEMWDPAAQAFRLNNPGTTVFTEDCNVLLKLVMAGEVTNSLGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSYRRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEIQNGASNSEIPYNGEPLSWFQRQLRGSHYQPILRDHICKDMSPLVAARMRHIPLFPGSDWRDLPNIQVRLGDGVIAHKLQYTFHDVKNGYSSTGALRGVCSCAEGKACDPESRQFSTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDSYRFFGNILDRHRQVGNAVPPPLAKAIGLEIKLCLLSSARESASAAVKAKEEAATKD se6l1_mouse_gene SE6L1_MOUSE_GENE/SEZ6L gene gene mouse Mus musculus Mouse sfrp5_mouse_gene SFRP5_MOUSE_GENE gene gene mouse Mus musculus Mouse sox17_mouse_gene SOX17_MOUSE_GENE gene gene mouse Mus musculus Mouse suz12_human Polycomb protein SUZ12 CHET9 JJAZ1 KIAA0160 SUZ12 Suppressor of zeste 12 protein homolog Joined to JAZF1 protein Chromatin precipitated E2F target 9 protein protein protein human Homo sapiens Human MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL eed_human Polycomb protein EED EED WD protein associating with integrin cytoplasmic tails 1 Embryonic ectoderm development protein protein protein human Homo sapiens Human MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR eed_mouse Polycomb protein EED Eed protein protein mouse Mus musculus Mouse MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR myc-sirt1 1241962 n/a 1241970 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241971 unspecified role unspecified role bait bait association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). myc-h2afx 1241962 n/a 1241972 unspecified role unspecified role bait bait n/a 1241970 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). myc-dnmt1 1241962 n/a 1241973 unspecified role unspecified role bait bait n/a 1241970 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). myc-ezh2-4 1241962 n/a 1241974 unspecified role unspecified role bait bait n/a 1241970 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). myc-dnmt3b 1241962 n/a 1241970 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241975 unspecified role unspecified role bait bait association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). sirt1-actb 1241962 n/a 1241976 unspecified role unspecified role prey prey n/a 1241971 unspecified role unspecified role bait bait association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). ezh2-actb-1 1241962 n/a 1241977 unspecified role unspecified role prey prey n/a 1241974 unspecified role unspecified role bait bait association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). dnmt3b-actb 1241962 n/a 1241977 unspecified role unspecified role prey prey n/a 1241975 unspecified role unspecified role bait bait association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). dnmt1-actb-1 1241962 n/a 1241977 unspecified role unspecified role prey prey n/a 1241973 unspecified role unspecified role bait bait association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). h2afx-actb-1 1241962 n/a 1241972 unspecified role unspecified role bait bait n/a 1241977 unspecified role unspecified role prey prey association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). ezh2-rl13 1241962 n/a 1241976 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241974 unspecified role unspecified role bait bait association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). dnmt3b-rl13 1241962 n/a 1241975 unspecified role unspecified role bait bait n/a 1241976 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). dnmt1-rl13 1241962 n/a 1241973 unspecified role unspecified role bait bait n/a 1241976 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). h2afx-rl13 1241962 n/a 1241972 unspecified role unspecified role bait bait n/a 1241976 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). sirt1-actb-1 1241962 n/a 1241977 unspecified role unspecified role prey prey n/a 1241971 unspecified role unspecified role bait bait association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). sirt1-rl10a 1241962 n/a 1241978 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241971 unspecified role unspecified role bait bait association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). h2afx-rl10a 1241962 n/a 1241972 unspecified role unspecified role bait bait n/a 1241978 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). dnmt1-rl10a 1241962 n/a 1241978 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241973 unspecified role unspecified role bait bait association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). dnmt3b-rl10a 1241962 n/a 1241978 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241975 unspecified role unspecified role bait bait association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). ezh2-rl10a 1241962 n/a 1241978 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241974 unspecified role unspecified role bait bait association association false false false 5D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). sirt1-sfrp4 1241962 n/a 1241971 unspecified role unspecified role bait bait n/a 1241979 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins h2afx-sirt1 1241962 n/a 1241972 unspecified role unspecified role bait bait n/a 1241979 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-sfrp4 1241962 n/a 1241973 unspecified role unspecified role bait bait n/a 1241979 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-dnmt3b 1241962 n/a 1241979 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241975 unspecified role unspecified role bait bait association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins ezh2-sfrp4 1241962 n/a 1241979 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241974 unspecified role unspecified role bait bait association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins ezh2-epdr1 1241962 n/a 1241974 unspecified role unspecified role bait bait n/a 1241980 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt3b-ezh2-2 1241962 n/a 1241975 unspecified role unspecified role bait bait n/a 1241980 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-epdr1 1241962 n/a 1241973 unspecified role unspecified role bait bait n/a 1241980 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-h2afx-1 1241962 n/a 1241972 unspecified role unspecified role bait bait n/a 1241980 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins h2afx-sirt1-1 1241962 n/a 1241980 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241971 unspecified role unspecified role bait bait association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins sirt1-epdr1 1241962 n/a 1241971 unspecified role unspecified role bait bait n/a 1241981 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins h2afx-sirt1-2 1241962 n/a 1241972 unspecified role unspecified role bait bait n/a 1241981 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-h2afx-2 1241962 n/a 1241973 unspecified role unspecified role bait bait n/a 1241981 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-dnmt3b-2 1241962 n/a 1241981 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241975 unspecified role unspecified role bait bait association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt3b-ezh2-3 1241962 n/a 1241974 unspecified role unspecified role bait bait n/a 1241981 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins ezh2-epmip 1241962 n/a 1241982 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241974 unspecified role unspecified role bait bait association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt3b-ezh2-4 1241962 n/a 1241975 unspecified role unspecified role bait bait n/a 1241982 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-dnmt3b-3 1241962 n/a 1241973 unspecified role unspecified role bait bait n/a 1241982 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-h2afx-3 1241962 n/a 1241972 unspecified role unspecified role bait bait n/a 1241982 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins h2afx-sirt1-3 1241962 n/a 1241982 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241971 unspecified role unspecified role bait bait association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins sirt1-mlh1 1241962 n/a 1241983 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241971 unspecified role unspecified role bait bait association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins h2afx-sirt1-4 1241962 n/a 1241972 unspecified role unspecified role bait bait n/a 1241983 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-h2afx-4 1241962 n/a 1241983 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241973 unspecified role unspecified role bait bait association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-dnmt3b-4 1241962 n/a 1241975 unspecified role unspecified role bait bait n/a 1241983 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt3b-ezh2-5 1241962 n/a 1241983 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241974 unspecified role unspecified role bait bait association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins ezh2-sfrp5 1241962 n/a 1241974 unspecified role unspecified role bait bait n/a 1241984 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt3b-ezh2-6 1241962 n/a 1241975 unspecified role unspecified role bait bait n/a 1241984 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-dnmt3b-5 1241962 n/a 1241973 unspecified role unspecified role bait bait n/a 1241984 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-h2afx-5 1241962 n/a 1241972 unspecified role unspecified role bait bait n/a 1241984 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins h2afx-sirt1-5 1241962 n/a 1241984 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241971 unspecified role unspecified role bait bait association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins sirt1-gata4 1241962 n/a 1241971 unspecified role unspecified role bait bait n/a 1241985 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins h2afx-sirt1-6 1241962 n/a 1241972 unspecified role unspecified role bait bait n/a 1241985 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-h2afx-6 1241962 n/a 1241985 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241973 unspecified role unspecified role bait bait association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-dnmt3b-6 1241962 n/a 1241975 unspecified role unspecified role bait bait n/a 1241985 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt3b-ezh2-7 1241962 n/a 1241974 unspecified role unspecified role bait bait n/a 1241985 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins ezh2-gata4 1241962 n/a 1241986 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241974 unspecified role unspecified role bait bait association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt3b-ezh2-8 1241962 n/a 1241975 unspecified role unspecified role bait bait n/a 1241986 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-dnmt3b-7 1241962 n/a 1241986 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241973 unspecified role unspecified role bait bait association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-h2afx-7 1241962 n/a 1241972 unspecified role unspecified role bait bait n/a 1241986 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins h2afx-sirt1-7 1241962 n/a 1241971 unspecified role unspecified role bait bait n/a 1241986 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins sirt1-gata5 1241962 n/a 1241971 unspecified role unspecified role bait bait n/a 1241987 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins h2afx-sirt1-8 1241962 n/a 1241972 unspecified role unspecified role bait bait n/a 1241987 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-h2afx-8 1241962 n/a 1241987 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241973 unspecified role unspecified role bait bait association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt1-dnmt3b-8 1241962 n/a 1241975 unspecified role unspecified role bait bait n/a 1241987 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins dnmt3b-ezh2-9 1241962 n/a 1241987 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241974 unspecified role unspecified role bait bait association association false false false 6D Genes with a high frequency for developing cancer-specific, abnormal, CpG island DNA hypermethylation in colon cancer have damage-induced enrichment of silencing proteins ezh2-myl6b-1 1241962 n/a 1241988 unspecified role unspecified role prey prey n/a 1241974 unspecified role unspecified role bait bait association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. ezh2-ptn-1 1241962 n/a 1241974 unspecified role unspecified role bait bait n/a 1241989 unspecified role unspecified role prey prey association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. ezh2-myl6-2 1241962 n/a 1241990 unspecified role unspecified role prey prey n/a 1241974 unspecified role unspecified role bait bait association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. ezh2-xct-1 1241962 n/a 1241974 unspecified role unspecified role bait bait n/a 1241991 unspecified role unspecified role prey prey association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. ezh2-pkha6-1 1241962 n/a 1241992 unspecified role unspecified role prey prey n/a 1241974 unspecified role unspecified role bait bait association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt3b-pkha6-1 1241962 n/a 1241975 unspecified role unspecified role bait bait n/a 1241992 unspecified role unspecified role prey prey association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt3b-myl6b-1 1241962 n/a 1241975 unspecified role unspecified role bait bait n/a 1241988 unspecified role unspecified role prey prey association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt3b-myl6-2 1241962 n/a 1241990 unspecified role unspecified role prey prey n/a 1241975 unspecified role unspecified role bait bait association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt3b-ptn-1 1241962 n/a 1241989 unspecified role unspecified role prey prey n/a 1241975 unspecified role unspecified role bait bait association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt3b-xct-1 1241962 n/a 1241991 unspecified role unspecified role prey prey n/a 1241975 unspecified role unspecified role bait bait association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. sirt1-pkha6-1 1241962 n/a 1241971 unspecified role unspecified role bait bait n/a 1241992 unspecified role unspecified role prey prey association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. sirt1-myl6b-1 1241962 n/a 1241988 unspecified role unspecified role prey prey n/a 1241971 unspecified role unspecified role bait bait association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. sirt1-myl6-2 1241962 n/a 1241971 unspecified role unspecified role bait bait n/a 1241990 unspecified role unspecified role prey prey association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. sirt1-ptn-1 1241962 n/a 1241971 unspecified role unspecified role bait bait n/a 1241989 unspecified role unspecified role prey prey association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. sirt1-xct-1 1241962 n/a 1241991 unspecified role unspecified role prey prey n/a 1241971 unspecified role unspecified role bait bait association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt1-pkha6-1 1241962 n/a 1241973 unspecified role unspecified role bait bait n/a 1241992 unspecified role unspecified role prey prey association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt1-myl6b-1 1241962 n/a 1241988 unspecified role unspecified role prey prey n/a 1241973 unspecified role unspecified role bait bait association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt1-myl6-2 1241962 n/a 1241990 unspecified role unspecified role prey prey n/a 1241973 unspecified role unspecified role bait bait association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt1-ptn-1 1241962 n/a 1241973 unspecified role unspecified role bait bait n/a 1241989 unspecified role unspecified role prey prey association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. dnmt1-xct-1 1241962 n/a 1241991 unspecified role unspecified role prey prey n/a 1241973 unspecified role unspecified role bait bait association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. h2afx-pkha6-1 1241962 n/a 1241972 unspecified role unspecified role bait bait n/a 1241992 unspecified role unspecified role prey prey association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. h2afx-myl6b-1 1241962 n/a 1241972 unspecified role unspecified role bait bait n/a 1241988 unspecified role unspecified role prey prey association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. h2afx-myl6-2 1241962 n/a 1241972 unspecified role unspecified role bait bait n/a 1241990 unspecified role unspecified role prey prey association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. h2afx-ptn-1 1241962 n/a 1241972 unspecified role unspecified role bait bait n/a 1241989 unspecified role unspecified role prey prey association association false false false S4G The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. h2afx-xct-1 1241962 n/a 1241972 unspecified role unspecified role bait bait n/a 1241991 unspecified role unspecified role prey prey association association false false false The position of peaks also correlates with areas of high GC content, including but not limited to CpG islands. S4G dnmt3b-myc 1241963 n/a 1241970 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241975 unspecified role unspecified role bait bait association association false false false S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). ezh2-myc 1241963 n/a 1241970 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241974 unspecified role unspecified role bait bait association association false false false S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). h2afx-myc 1241963 n/a 1241972 unspecified role unspecified role bait bait n/a 1241970 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). sirt1-myc-1 1241963 n/a 1241971 unspecified role unspecified role bait bait n/a 1241970 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). dnmt1-myc 1241963 n/a 1241970 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241973 unspecified role unspecified role bait bait association association false false false S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). h2afx-actb-2 1241963 n/a 1241972 unspecified role unspecified role bait bait n/a 1241977 unspecified role unspecified role prey prey association association false false false S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). dnmt1-actb-2 1241963 n/a 1241977 unspecified role unspecified role prey prey n/a 1241973 unspecified role unspecified role bait bait association association false false false S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). ezh2-actb-2 1241963 n/a 1241974 unspecified role unspecified role bait bait n/a 1241977 unspecified role unspecified role prey prey association association false false false S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). sirt1-actb-2 1241963 n/a 1241971 unspecified role unspecified role bait bait n/a 1241977 unspecified role unspecified role prey prey association association false false false S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). dnmt3b-actb-1 1241963 n/a 1241977 unspecified role unspecified role prey prey n/a 1241975 unspecified role unspecified role bait bait association association false false false S4D The position of peaks correlates with areas of high GC content, including but not limited to CpG islands (Figure 5D). These genomic analyses were confirmed by local ChIP and quantitative PCR (Figure S4D). ezh2-fbn1 1241964 n/a 1241993 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241994 unspecified role unspecified role bait bait association association false false false Fig 7C Lower-expression genes, such as Fbn1, Sez6l, Sfrp5, and Sox17, that have higher basal levels of EZH2 than the high-expression genes, all have more enrichment of EZH2 and DNMT1 at their promoter CpG islands in inflamed distal epithelial cells from ETBF mice compared to sham mice. dnmt1-fbn1 1241964 n/a 1241993 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241995 unspecified role unspecified role bait bait association association false false false Fig 7C Lower-expression genes, such as Fbn1, Sez6l, Sfrp5, and Sox17, that have higher basal levels of EZH2 than the high-expression genes, all have more enrichment of EZH2 and DNMT1 at their promoter CpG islands in inflamed distal epithelial cells from ETBF mice compared to sham mice. dnmt1-fbn1-1 1241964 n/a 1241996 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241995 unspecified role unspecified role bait bait association association false false false Fig 7C Lower-expression genes, such as Fbn1, Sez6l, Sfrp5, and Sox17, that have higher basal levels of EZH2 than the high-expression genes, all have more enrichment of EZH2 and DNMT1 at their promoter CpG islands in inflamed distal epithelial cells from ETBF mice compared to sham mice. ezh2-se6l1 1241964 n/a 1241996 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241994 unspecified role unspecified role bait bait association association false false false Fig 7C Lower-expression genes, such as Fbn1, Sez6l, Sfrp5, and Sox17, that have higher basal levels of EZH2 than the high-expression genes, all have more enrichment of EZH2 and DNMT1 at their promoter CpG islands in inflamed distal epithelial cells from ETBF mice compared to sham mice. ezh2-se6l1-1 1241964 n/a 1241997 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241994 unspecified role unspecified role bait bait association association false false false Fig 7C Lower-expression genes, such as Fbn1, Sez6l, Sfrp5, and Sox17, that have higher basal levels of EZH2 than the high-expression genes, all have more enrichment of EZH2 and DNMT1 at their promoter CpG islands in inflamed distal epithelial cells from ETBF mice compared to sham mice. dnmt1-sfrp5 1241964 n/a 1241995 unspecified role unspecified role bait bait n/a 1241997 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 7C Lower-expression genes, such as Fbn1, Sez6l, Sfrp5, and Sox17, that have higher basal levels of EZH2 than the high-expression genes, all have more enrichment of EZH2 and DNMT1 at their promoter CpG islands in inflamed distal epithelial cells from ETBF mice compared to sham mice. dnmt1-sfrp5-1 1241964 n/a 1241998 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241995 unspecified role unspecified role bait bait association association false false false Fig 7C Lower-expression genes, such as Fbn1, Sez6l, Sfrp5, and Sox17, that have higher basal levels of EZH2 than the high-expression genes, all have more enrichment of EZH2 and DNMT1 at their promoter CpG islands in inflamed distal epithelial cells from ETBF mice compared to sham mice. ezh2-sox17 1241964 n/a 1241994 unspecified role unspecified role bait bait n/a 1241998 unspecified role unspecified role prey prey promoter_cpg_island sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 7C Lower-expression genes, such as Fbn1, Sez6l, Sfrp5, and Sox17, that have higher basal levels of EZH2 than the high-expression genes, all have more enrichment of EZH2 and DNMT1 at their promoter CpG islands in inflamed distal epithelial cells from ETBF mice compared to sham mice. dnmt1-sirt1-4 1241965 n/a 1241971 unspecified role unspecified role prey prey n/a 1241973 unspecified role unspecified role bait bait physical association physical association false false false 2A An interaction was only observed only after 30 minutes hydrogen peroxide exposure, or longer. sirt1-dnmt1-4 1241965 n/a 1241999 unspecified role unspecified role prey prey n/a 1241971 unspecified role unspecified role bait bait n/a 1242000 unspecified role unspecified role prey prey n/a 1241974 unspecified role unspecified role prey prey n/a 1241973 unspecified role unspecified role prey prey association association false false false 2C hydrogen peroxide dnmt3b-sirt1 1241965 n/a 1241975 unspecified role unspecified role bait bait n/a 1241999 unspecified role unspecified role prey prey n/a 1241971 unspecified role unspecified role prey prey n/a 1242000 unspecified role unspecified role prey prey n/a 1241973 unspecified role unspecified role prey prey n/a 1241974 unspecified role unspecified role prey prey association association false false false 2D, 3B. hydrogen peroxide After H2O2 treatment, it can be seen the proteins are present in a much larger complex(es), and that after H2O2 treatment, SIRT1 interacts with DNMT3B. dnmt1-eed-4 1241966 n/a 1242000 unspecified role unspecified role prey prey n/a 1241974 unspecified role unspecified role prey prey n/a 1241973 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1241971 unspecified role unspecified role prey prey association association false false false 2B hydrogen peroxide dnmt1-eed-5 1241966 n/a 1241974 unspecified role unspecified role prey prey n/a 1241971 unspecified role unspecified role prey prey n/a 1241973 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 3C hydrogen peroxide As for DNMT3B, DNMT1 interacts with EZH2 and SIRT1 as part of a large multiprotein complex(es) after H2O2 treatment. ezh2-dnmt1-2 1241966 n/a 1242000 unspecified role unspecified role prey prey n/a 1241974 unspecified role unspecified role bait bait n/a 1241971 unspecified role unspecified role prey prey n/a 1241973 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 3D hydrogen peroxide In this Re-IP, an initial co-IP was carried out using FLAG-DNMT1 as bait, then a second IP was done using anti-EZH2 antibodies. dnmt1-ezh2-3 1241967 n/a 1241972 unspecified role unspecified role neutral component neutral component n/a 1241971 unspecified role unspecified role neutral component neutral component n/a 1241973 unspecified role unspecified role neutral component neutral component n/a 1241974 unspecified role unspecified role neutral component neutral component association association false false false 4 After H2O2 treatment, DNMT1, SIRT1, and DNMT3B, and to a lesser extent SUZ12, EZH2, and EED proteins all migrate in the gradient in regions of higher molecular mass (greater than 650 kDa) than in untreated cells. dnmt3b-dnmt1-1 1241968 n/a 1241975 unspecified role unspecified role neutral component neutral component n/a 1242000 unspecified role unspecified role neutral component neutral component n/a 1241973 unspecified role unspecified role neutral component neutral component n/a 1241974 unspecified role unspecified role neutral component neutral component n/a 1241971 unspecified role unspecified role neutral component neutral component n/a 1241999 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3A After H2O2 treatment, DNMT1, SIRT1, and DNMT3B, and to a lesser extent SUZ12, EZH2, and EED proteins all migrate in the gradient in regions of higher molecular mass (greater than 650 kDa) than in untreated cells. ezh2-dnmt1-3 1241969 n/a 1241994 unspecified role unspecified role bait bait n/a 1242001 unspecified role unspecified role prey prey n/a 1241995 unspecified role unspecified role prey prey association association false false false The DNMT1 band is more prominent in the tissue from the distal colon of the ETBF mice. 7B, S6D.