IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tao-2011-9 PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. human-u937_pr9 Homo sapiens U937-PR9 lymphoma cells expressing zinc-inducible PML-RAR alpha u937_pr9 U937-PR9 hematopoietic precursor cells expressing zinc-inducible PML-RAR alpha U937-PR9 cells, which are hematopoietic precursor cells carrying the PML-RARa coding sequence under the control of a zinc-inducible promoter. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Blood (0006-4971) 2011 Only protein-protein interactions imex curation tao-2011-10 PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. human-nb4 Human NB4 APL cell line nb4 NB4 human acute promyelocytic leukemia cells Human acute promyelocytic leukemia established from the bone marrow of a 23- year-old woman with acute promyelocytic leukemia (APL = AML FAB M3) in second relapse in 1989; patented cell line; cells carry the t(15;17) PML-RARA fusion gene confirmed as human with IEF of AST, MDH anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Blood (0006-4971) 2011 Only protein-protein interactions imex curation tao-2011-2 PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Blood (0006-4971) 2011 Only protein-protein interactions imex curation tao-2011-7 PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. mouse-liver Mus musculus liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Blood (0006-4971) 2011 Only protein-protein interactions imex curation tao-2011-11 PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Blood (0006-4971) 2011 Only protein-protein interactions imex curation tao-2011-1 PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. human-hl_60 Homo sapiens acute myeloid leukemia cell line hl_60 human acute myeloid leukemia cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Blood (0006-4971) 2011 Only protein-protein interactions imex curation tao-2011-3 PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Blood (0006-4971) 2011 Only protein-protein interactions imex curation tao-2011-4 PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. mouse-kidney Mus musculus kidney kidney [Renal] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Blood (0006-4971) 2011 Only protein-protein interactions imex curation tao-2011-5 PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. mouse-spleen Mus musculus spleen spleen spleen anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Blood (0006-4971) 2011 Only protein-protein interactions imex curation tao-2011-6 PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. mouse-lung Mus musculus lung anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Blood (0006-4971) 2011 Only protein-protein interactions imex curation tao-2011-8 PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. mouse-skeletal-muscle Mus musculus skeletal muscle. skeletal_muscle Skeletal muscle anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Blood (0006-4971) 2011 Only protein-protein interactions imex curation tao-2011-12 PMLRARα binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo. human-apl-primary Human acute promyelocytic leukemia primary cells apl-primary Acute promyelocytic leukemia primary cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tao R.H., Berkova Z., Wise J.F., Rezaeian A.H., Daniluk U., Ao X., Hawke D.H., Karp J.E., Lin H.K., Molldrem J.J., Samaniego F. Apoptosis - Interactions involving proteins with a function related to apoptosis PML-RAR protein is a chimeric protein resulting from the fusion of PML (P29590 ) and RARA (P10276). There are two possible versions of this protein, depending on the point in the PML protein where the fusion with RARA occurs. It was not possible to ascertain which one of the two versions was used in this paper.Only one TrEMBL entry was available and it was anyway used to represent this protein (fusion point in residues 394-395 of PML). fsamaniego@mdanderson.org Blood (0006-4971) 2011 Only protein-protein interactions imex curation tnr6_human Tumor necrosis factor receptor superfamily member 6 FASLG receptor Apoptosis-mediating surface antigen FAS Apo-1 antigen FAS APT1 TNFRSF6 FAS1 protein protein human Homo sapiens Human MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV ch-11 antibody ch-11 hFAS-activating monoclonal antibody protein protein mouse Mus musculus Mouse Monoclonal antibody developed in mouse cells against human protein FAS (P25445). tnfl6_human Tumor necrosis factor ligand superfamily member 6 Fas antigen ligand CD95L Apoptosis antigen ligand FASLG APT1LG1 FASL TNFSF6 CD95 ligand protein protein human Homo sapiens Human MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL cflar_human CASP8 and FADD-like apoptosis regulator Cellular FLICE-like inhibitory protein Caspase-eight-related protein Caspase-like apoptosis regulatory protein MACH-related inducer of toxicity Caspase homolog Inhibitor of FLICE FADD-like antiapoptotic molecule 1 Usurpin CFLAR CASH CLARP MRIT CASP8AP1 protein protein human Homo sapiens Human MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS q15156_human PML-RAR protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKAIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP pml_human Protein PML PML MYL RNF71 TRIM19 Tripartite motif-containing protein 19 RING finger protein 71 Promyelocytic leukemia protein PP8675 E3 SUMO-protein ligase PML RING-type E3 SUMO transferase PML protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPEEAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS tnr6_mouse Tumor necrosis factor receptor superfamily member 6 Fas Apt1 Tnfrsf6 FASLG receptor Apoptosis-mediating surface antigen FAS Apo-1 antigen protein protein mouse Mus musculus Mouse MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLIPLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKFARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLDKFQDMVQKDLGKSTPDTGNENEGQCLE pml_mouse Protein PML Pml protein protein mouse Mus musculus Mouse METEPVSVQKVPAPPGSPCRQQDSALTPTPTMPPPEEPSEDYEHSQSPAEQAIQEEFQFLRCPSCQAQAKCPKLLPCLHTLCSGCLEAPGLQCPICKAPGQADANGEALDNVFFESLQRRLAVFRQIVDAQAACTRCKGLADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDNSVSSFLDSTRKSNIFCSNTNHRNPALTDIYCRGCAKPLCCTCALLDRNHSHLHCDIGEEIQQWHEELGTMTQTLEEQGRTFDSAHAQMCSAIGQLDHARADIEKQIRARVRQVVDYVQAQERELLEAVNDRYQRDYQEIAGQLSCLEAVLQRIRTSGALVKRMKLYASDQEVLDMHSFLRKALCSLRQEEPQNQKVQLLTRGFEEFKLCLQDFISCITQRINAAVASPEAASNQPEAASTHPVTTSTPEDLEQPKEVQSVQAQALELSKTQPVAMVKTVPGAHPVPVYAFSMQGPTYREEASQTVGSMKRKCSHEDCSRKIIKMESTEENEDRLATSSPEQSWPSTFKATSPPHLDGTSNPESTVPEKKILLPNNNHVTSDTGETEERVVVISSSEDSDTENLSSHELDDSSSESSSLQLEGPNSLKALDESLAEPHLEDRTLVFFDLKIDNETQKISQLAAVNRESKFRVLIQPEAFSVYSKAVSLEAGLRHFLSFLTTMHRPILACSRLWGPGLPIFFQTLSDINKLWEFQDTISGFLAVLPLIRERIPGASSFKLGNLAKTYLARNMSERSALASVLAMRDLCCLLEISPGLPLAQHIYSFSSLQCFASLQPLIQASVLPQSEARLLALHNVSFVELLNAYRTNRQEGLKKYVHYLSLQTTPLSSSASTQVAQFLQALSTHMEGLLEGHAPAGAEGKAESKGCLA ch_11_antibody-fas 1266676 n/a 1266688 unspecified role unspecified role prey prey n/a 1266689 unspecified role unspecified role bait bait physical association physical association false false false 5a Induction of the expression of PML-RAR-alpha through ZnSO4 treatment decreases the interaction. faslg-fas 1266676 n/a 1266688 unspecified role unspecified role prey prey n/a 1266690 unspecified role unspecified role bait bait physical association physical association false false false 5b Induction of the expression of PML-RAR-alpha through ZnSO4 treatment decreases the interaction. fas-casp8-13 1266676 n/a 1266691 unspecified role unspecified role prey prey n/a 1266692 unspecified role unspecified role prey prey n/a 1266693 unspecified role unspecified role prey prey n/a 1266688 unspecified role unspecified role bait bait association association false false false 6a fas-casp8-14 1266676 n/a 1266688 unspecified role unspecified role bait bait n/a 1266693 unspecified role unspecified role prey prey n/a 1266694 unspecified role unspecified role prey prey n/a 1266691 unspecified role unspecified role prey prey n/a 1266692 unspecified role unspecified role prey prey association association false false false 6a Expression and co-inmunoprecipitation of PML-RARA dependent of ZnSO4 treatment. faslg-fas-1 1266677 n/a 1266688 unspecified role unspecified role prey prey n/a 1266690 unspecified role unspecified role bait bait physical association physical association false false false 5c Knock-down of PML-RAR-alpha increases the interaction. fas-pml_rar 1266677 n/a 1266688 unspecified role unspecified role bait bait n/a 1266694 unspecified role unspecified role prey prey physical association physical association false false false 1a, 1d pml_rar-fas 1266677 n/a 1266688 unspecified role unspecified role prey prey n/a 1266694 unspecified role unspecified role bait bait physical association physical association false false false 1a cflar-pml_rar 1266677 n/a 1266691 unspecified role unspecified role bait bait n/a 1266694 unspecified role unspecified role prey prey physical association physical association false false false 6b (left) fas-pml-1 1266678 n/a 1266695 unspecified role unspecified role prey prey n/a 1266688 unspecified role unspecified role bait bait physical association physical association false false false 1b fas-pml-11 1266678 n/a 1266688 unspecified role unspecified role bait bait n/a 1266695 unspecified role unspecified role prey prey b-box-containing region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 7b middle and right fas-pml-8 1266679 n/a 1266696 unspecified role unspecified role bait bait n/a 1266697 unspecified role unspecified role prey prey physical association physical association false false false 4b fas-cflar-1 1266679 n/a 1266694 unspecified role unspecified role prey prey n/a 1266688 unspecified role unspecified role bait bait n/a 1266691 unspecified role unspecified role prey prey association association false false false 7g Cells were treated with anti-fas antibody to induce apoptosis. pml-fas-1 1266680 n/a 1266695 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false b-box-containing region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1266688 unspecified role unspecified role prey prey physical association physical association false false false 7b left fas-pml_rar-1 1266680 n/a 1266694 unspecified role unspecified role prey prey n/a 1266688 unspecified role unspecified role bait bait plad containing region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false dd containing region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 7d fas-pml 1266681 n/a 1266688 unspecified role unspecified role bait bait n/a 1266695 unspecified role unspecified role prey prey physical association physical association false false false 1b fas-pml-9 1266682 n/a 1266696 unspecified role unspecified role bait bait n/a 1266697 unspecified role unspecified role prey prey physical association physical association false false false 4b fas-pml-3 1266683 n/a 1266696 unspecified role unspecified role bait bait n/a 1266697 unspecified role unspecified role prey prey physical association physical association false false false 4b fas-pml-4 1266684 n/a 1266696 unspecified role unspecified role bait bait n/a 1266697 unspecified role unspecified role prey prey physical association physical association false false false 4b fas-pml-5 1266685 n/a 1266696 unspecified role unspecified role bait bait n/a 1266697 unspecified role unspecified role prey prey physical association physical association false false false 4b fas-pml-7 1266686 n/a 1266696 unspecified role unspecified role bait bait n/a 1266697 unspecified role unspecified role prey prey physical association physical association false false false 4b fas-cflar 1266687 n/a 1266691 unspecified role unspecified role prey prey n/a 1266694 unspecified role unspecified role prey prey n/a 1266688 unspecified role unspecified role bait bait association association false false false 6b (right) and 1c