IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ seong-2011a-2 Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9, a zinc finger protein. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Seong H.A., Jung H., Manoharan R., Ha H. Apoptosis - Interactions involving proteins with a function related to apoptosis hyunha@chungbuk.ac.kr J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation seong-2011a-6 Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9, a zinc finger protein. in vitro In vitro in gel kinase assay in-gel kinase assay in gel kinase assay autoradiography autoradiography Seong H.A., Jung H., Manoharan R., Ha H. Apoptosis - Interactions involving proteins with a function related to apoptosis hyunha@chungbuk.ac.kr J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation seong-2011a-7 Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9, a zinc finger protein. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down anti tag western anti tag western blot anti tag western Seong H.A., Jung H., Manoharan R., Ha H. Apoptosis - Interactions involving proteins with a function related to apoptosis znf622 and map3k5 construct origins inferred from mutants mapping. hyunha@chungbuk.ac.kr J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation seong-2011a-5 Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9, a zinc finger protein. in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel autoradiography autoradiography Seong H.A., Jung H., Manoharan R., Ha H. Apoptosis - Interactions involving proteins with a function related to apoptosis hyunha@chungbuk.ac.kr J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation seong-2011a-3 Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9, a zinc finger protein. human-hacat Homo sapiens immortalised keratinocytes hacat human immortalised keratinocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Seong H.A., Jung H., Manoharan R., Ha H. Apoptosis - Interactions involving proteins with a function related to apoptosis hyunha@chungbuk.ac.kr J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation seong-2011a-4 Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9, a zinc finger protein. mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Seong H.A., Jung H., Manoharan R., Ha H. Apoptosis - Interactions involving proteins with a function related to apoptosis hyunha@chungbuk.ac.kr J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation zn622_human Zinc finger protein 622 ZPR9 Zinc finger-like protein 9 ZNF622 protein protein human Homo sapiens Human MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQAVNRKVEMMNEKNLEKGLGVDSVDKDAMNAAIQQAIKAQPSMSPKKAPPAPAKEARNVVAVGTGGRGTHDRDPSEKPPRLQWFEQQAKKLAKQQEEDSEEEEEDLDGDDWEDIDSDEELECEDTEAMDDVVEQDAEEEEAEEGPPLGAIPITDCLFCSHHSSSLMKNVAHMTKDHSFFIPDIEYLSDIKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLFTDGDAALEFADFYDFRSSYPDHKEGEDPNKAEELPSEKNLEYDDETMELILPSGARVGHRSLMRYYKQRFGLSRAVAVAKNRKAVGRVLQQYRALGWTGSTGAALMRERDMQYVQRMKSKWMLKTGMKNNATKQMHFRVQVRF m3k5_human Mitogen-activated protein kinase kinase kinase 5 MAPK/ERK kinase kinase 5 Apoptosis signal-regulating kinase 1 MAP3K5 ASK1 MAPKKK5 MEKK5 protein protein human Homo sapiens Human MSTEADEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESAAAPGIGCPAATSSSSATRGRGSSVGGGSRRTTVAYVINEASQGQLVVAESEALQSLREACETVGATLETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILYCDTNSDSLQSLKEIICQKNTMCTGNYTFVPYMITPHNKVYCCDSSFMKGLTELMQPNFELLLGPICLPLVDRFIQLLKVAQASSSQYFRESILNDIRKARNLYTGKELAAELARIRQRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHHVKFHYAFALNRRNLPGDRAKALDIMIPMVQSEGQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFKKAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGFFLGASVLANDHMRVIQASEKLFKLKTPAWYLKSIVETILIYKHFVKLTTEQPVAKQELVDFWMDFLVEATKTDVTVVRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDKKGIHEWNFSASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKKFFEMVNTITEEKGRSTEEGDCESDLLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLVDEFLKVSSKKKKTQPKLSALSAGSNEYLRSISLPVPVLVEDTSSSSEYGSVSPDTELKVDPFSFKTRAKSCGERDVKGIRTLFLGIPDENFEDHSAPPSPEEKDSGFFMLRKDSERRATLHRILTEDQDKIVRNLMESLAQGAEEPKLKWEHITTLIASLREFVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADQEDLDVEDDHEEQPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT thio_human Thioredoxin ATL-derived factor Surface-associated sulphydryl protein TXN TRDX TRX TRX1 protein protein human Homo sapiens Human MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN mp2k3_human Dual specificity mitogen-activated protein kinase kinase 3 MAPK/ERK kinase 3 MAP2K3 MEK3 MKK3 PRKMK3 SKK2 Stress-activated protein kinase kinase 2 protein protein human Homo sapiens Human MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS m3k5_mouse Mitogen-activated protein kinase kinase kinase 5 MAPK/ERK kinase kinase 5 Apoptosis signal-regulating kinase 1 Map3k5 Ask1 Mekk5 protein protein mouse Mus musculus Mouse MGTEAGEGITFSVPPFASVGFCTIPEGGSCRRGGGAATAAEGEPSLQPLLVPPPPPPPGSFWNVESAAAPGTSCPTTAPGSSATRGRGNSGSGGGRRTTVAYVINEASQGQLVVAESEALQSLREACEAVGATLETLHFGKLDFGETAVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILYCDTNSDSLQSLKEIICQKNTVCTGNYTFIPYMVTPHNKVYCCDSSFMKGLTELMQPNFELLLGPICLPLVDRFVQLLKVAQASSSQYFRESILSDIRKARNLYTGKELAAELARIRQRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHHVKFHYAFALNRRNLPGDRAKALDIMIPMVQSEEQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFKKAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGFFLGASVLANDHLRVIQASEKLFRLKTPAWYLKSIVETILIYKHFVKLTTEQPSAKQELVDFWMDFLVEATKTDVTVVRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDKKGIHEWNFGASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKRFFEMVNTITEEKGRGAEDGDCEGDSLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLIDEFLKVSSKKKKTQPKLSALSTGSNEYLRSISLPVPVLVEDTSSSSEYGSVSPDTELKADPFSFKARAKSCGEKDGKGIRTLFLGIPDENFEDHSAPPSPEEKDSGFFMLRKDSERRATLHRILTEDQDKVVRNLMESLAQGAEEPKLKWEHITTLISSLREFVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADPEDLDVEDEHEELSSNQTVRRPQAITEDAVATSGVSTLSSTVSHDSQNAHRSLNVQLGRMKIETNRLLEELVRKERELQALLHQAIEEKDQEIRHLKLKSQPIDIPGFPVCHLNSPGTTTEDSELPGWLRENGADEDTISRFLAEDYTLVDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKC zn622_mouse Zinc finger protein 622 Znf622 D15Ertd806e Zfp622 protein protein mouse Mus musculus Mouse MAALTCITCRVAFRDAELQRAHYKTDWHRYNLRRKVAAMAPVTAEGFQERVRAQRAVAEAAEASKGAATYCTACGKKFATFNAYENHLGSRRHAELERKAVRAASRRVELLNAKNLEKGLGADGVDKDAVNAAIQQAIKAQPSTSPKKAPFVPTDECGRAAAGARGVPERDPTEKPPRLQWFEQQAKKLAKQQWEDGEEEGEEEEEDDEDEDWEDIDSDDGLECEDPGVEDQDAEDAAAEESPPLGAIPITDCLFCSHHSSSLVKNVAHMTKVHSFFIPDIEYLSDLKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLFTDGDAALEFADFYDFRSSYPDYKEGQDPAELEALSTDKILECDDETMELILPSGARVGHRSLMRYYKQRFGLPRAVTVARNQKAVGRVLQQYRALGWMGSTGAALMRERDMQYVQRMKSKWMLKIGMKNNATKQMHFRAQVRF znf622-map3k5 1174102 n/a 1174108 unspecified role unspecified role bait bait n/a 1174109 unspecified role unspecified role prey prey physical association physical association false false false 1a right, 1c H2O2, TNF-a, ionomycin (drug inducing calcium overload) and thapsigargin (drug inducing ER stress) act increasing the interaction (fig 1c). map3k5-znf622-3 1174102 n/a 1174108 unspecified role unspecified role prey prey n/a 1174109 unspecified role unspecified role bait bait physical association physical association false false false 2d DTT and b-ME (reducing agents) can disrupt the interaction, but H2O2 (oxidative agent) does not have an effect on it. This points out that the interaction takes place through cys residues and is then dependent on the reducing state of the proteins (fig. 2d). map3k5-txn-2 1174102 n/a 1174110 unspecified role unspecified role prey prey n/a 1174108 unspecified role unspecified role prey prey n/a 1174109 unspecified role unspecified role bait bait association association false false false 6d H2O2 increases the interaction. map3k5-txn-1 1174102 n/a 1174110 unspecified role unspecified role prey prey n/a 1174109 unspecified role unspecified role bait bait physical association physical association false false false 6a (right) znf622 overexpression decreased the interaction in a concentration-dependent manner. znf622 siRNA knock -down had the opposite effect. H2O2 also decreased the interaction. map3k5-ywhab-2 1174102 n/a 1174111 unspecified role unspecified role prey prey n/a 1174109 unspecified role unspecified role bait bait physical association physical association false false false 6b (right) znf622 overexpression decreased the interaction in a concentration-dependent manner. znf622 siRNA knock -down had the opposite effect. H2O2 also decreased the interaction. map3k5-map2k3 1174102 n/a 1174112 unspecified role unspecified role prey prey n/a 1174109 unspecified role unspecified role bait bait physical association physical association false false false 6c (right) znf622 overexpression decreased the interaction in a concentration-dependent manner. znf622 siRNA knock -down had the opposite effect. H2O2 increases the interaction. map3k5-map2k3-2 1174102 n/a 1174108 unspecified role unspecified role prey prey n/a 1174109 unspecified role unspecified role bait bait n/a 1174112 unspecified role unspecified role prey prey association association false false false 6d znf622 overexpression decreased the interaction in a concentration-dependent manner. znf622 siRNA knock -down had the opposite effect. H2O2 increases the interaction. map3k5-ywhab-4 1174102 n/a 1174108 unspecified role unspecified role prey prey n/a 1174109 unspecified role unspecified role bait bait n/a 1174111 unspecified role unspecified role prey prey association association false false false 6d znf622 overexpression decreased the interaction in a concentration-dependent manner. znf622 siRNA knock -down had the opposite effect. H2O2 also decreased the interaction. map3k5-znf622-4 1174103 n/a 1174109 enzyme enzyme neutral component neutral component partially purified partially purified ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 1174108 enzyme target enzyme target substrate substrate neutral component neutral component purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q969S3:p.[Cys305Ser;Cys308Ser] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 3a left map3k5-znf622-5 1174103 n/a 1174109 enzyme enzyme neutral component neutral component partially purified partially purified Q99683:p.Lys709Arg mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. n/a 1174108 enzyme target enzyme target substrate substrate neutral component neutral component purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 3a left map3k5-znf622-6 1174103 n/a 1174109 enzyme enzyme neutral component neutral component purified purified ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1174108 enzyme target enzyme target substrate substrate neutral component neutral component purified purified Q969S3:p.Ser314Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q969S3:p.Thr318Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q969S3:p.[Ser314Ala;Thr318Ala] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q969S3:p.[Cys305Ser;Cys308Ser] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 3a left and 3b map3k5-map3k5-2 1174103 n/a 1174109 putative self putative self putative self putative self partially purified partially purified ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. phosphorylation phosphorylation reaction phosphorylation false true false 4a Flag-tagged Znf622 enhanced map3k5 kinase activity. C205S/C308S and S314A/T318A mutants only retained a fraction of this enhancing action. znf622-map3k5-6 1174104 n/a 1174108 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q969S3:p.Cys308Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q969S3:p.[Cys305Ser;Cys308Ser] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q969S3:p.Cys305Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1174109 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1a and 2b (right) znf622-map3k5-7 1174104 n/a 1174108 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1174109 unspecified role unspecified role prey prey c terminal region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2a znf622-map3k5-8 1174104 n/a 1174109 unspecified role unspecified role prey prey Q99683:p.[Cys1351Ser;Cys1360Ser] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c terminal region experimental feature experimental feature certain certain sequence position certain certain certain sequence position certain false flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q99683:p.Cys1360Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q99683:p.Cys1351Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1174108 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2a, 2b (left) znf622-map3k5-3 1174105 n/a 1174108 unspecified role unspecified role neutral component neutral component purified purified region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 1174109 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q99683:p.[Cys1351Ser;Cys1360Ser] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q99683:p.Cys1351Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q99683:p.Cys1360Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2c znf622-map3k5-5 1174105 n/a 1174109 unspecified role unspecified role neutral component neutral component purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1174108 unspecified role unspecified role neutral component neutral component purified purified Q969S3:p.Cys308Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q969S3:p.[Cys305Ser;Cys308Ser] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q969S3:p.Cys305Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1b, 2c znf622-map3k5-1 1174106 n/a 1174109 unspecified role unspecified role prey prey n/a 1174108 unspecified role unspecified role bait bait physical association physical association false false false 1a right znf622-map3k5-9 1174107 n/a 1174113 unspecified role unspecified role prey prey n/a 1174114 unspecified role unspecified role bait bait physical association physical association false false false 1a right