IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ he-2011-1 The LSD1-interacting protein GILP is a LITAF domain protein that negatively regulates hypersensitive cell death in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined He S., Tan G., Liu Q., Huang K., Ren J., Zhang X., Yu X., Huang P., An C. Apoptosis - Interactions involving proteins with a function related to apoptosis chcaian@pku.edu.cn PLoS ONE 2011 Only protein-protein interactions imex curation he-2011-2 The LSD1-interacting protein GILP is a LITAF domain protein that negatively regulates hypersensitive cell death in Arabidopsis. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western He S., Tan G., Liu Q., Huang K., Ren J., Zhang X., Yu X., Huang P., An C. Apoptosis - Interactions involving proteins with a function related to apoptosis chcaian@pku.edu.cn PLoS ONE 2011 Only protein-protein interactions imex curation gilp_arath GSH-induced LITAF domain protein GILP T19L5.5 T31B5_10 At5g13190 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKEGTTVIGVPYYAGQNPYQAGIVPPNAIYGDPLGAPIQQTIYRDTPAPFNCLYCGNTGLTNLRSKPGVAAVVACMMPFMLGFCFLCPSMDCLWNKQHHCPQCGNKVADFEKSDPCLVMDPPQWKQPSFALPA lsd1_arath Protein LSD1 LSD1 CHS4 Protein CHILLING SENSITIVE 4 Protein LESION SIMULATING DISEASE 1 Putative zinc finger LSD1 F9F13.30 At4g20380 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKVADMQDQLVCHGCRNLLMYPRGASNVRCALCNTINMVPPPPPPHDMAHIICGGCRTMLMYTRGASSVRCSCCQTTNLVPAHSNQVAHAPSSQVAQINCGHCRTTLMYPYGASSVKCAVCQFVTNVNMSNGRVPLPTNRPNGTACPPSTSTSTPPSQTQTVVVENPMSVDESGKLVSNVVVGVTTDKK miel1_arath E3 ubiquitin-protein ligase MIEL1 PILP1 Pirh2-like protein 1 MIEL1 MYB30-interacting E3 ligase 1 RING-type E3 ubiquitin transferase MIEL1 T1A4.30 At5g18650 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEASPNDRLHFGKMGFGCKHYKRRCQIRAPCCNEVFDCRHCHNESTSTLRNIYDRHDLVRQDVKQVICSVCDTEQPAAQVCSNCGVNMGEYFCSICIFYDDDTEKQQFHCDDCGICRVGGRENFFHCKKCGSCYAVGLRNNHRCVENSMRHHCPICYEYLFDSLKDTNVMKCGHTMHVECYNEMIKRDKFCCPICSRSVIDMSKTWQRLDEEIEATAMPSDYRDKKVWILCNDCNDTTEVHFHIIGQKCGHCRSYNTRAIAPPVLPQ q94cd4-lsd1 1314797 n/a 1314799 unspecified role unspecified role bait bait n/a 1314800 unspecified role unspecified role prey prey physical association physical association false false false 3a q94cd4-q8vzk0 1314797 n/a 1314801 unspecified role unspecified role prey prey n/a 1314799 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false S2 q94cd4-lsd1-1 1314798 n/a 1314800 unspecified role unspecified role prey prey partially purified partially purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1314799 unspecified role unspecified role bait bait purified purified n-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 3b and 4b lsd1-q94cd4 1314798 n/a 1314799 unspecified role unspecified role prey prey purified purified region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1314800 unspecified role unspecified role bait bait partially purified partially purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 4d