IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ biton-2011-1 NEMO and RIP1 control cell fate in response to extensive DNA damage via TNF-α feedforward signaling. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Biton S., Ashkenazi A. Apoptosis - Interactions involving proteins with a function related to apoptosis aa@gene.com Cell (0092-8674) 2011 Only protein-protein interactions imex curation biton-2011-2 NEMO and RIP1 control cell fate in response to extensive DNA damage via TNF-α feedforward signaling. human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Biton S., Ashkenazi A. Apoptosis - Interactions involving proteins with a function related to apoptosis aa@gene.com Cell (0092-8674) 2011 Only protein-protein interactions imex curation biton-2011-3 NEMO and RIP1 control cell fate in response to extensive DNA damage via TNF-α feedforward signaling. human-mda_mb_435 Human cell line derived from the M14 melanoma cell line mda_mb_435 Human cell line derived from the M14 melanoma cell line This cell line is now thought to be derived from the M14 melanoma cell line. This cell line was originally thought to be a Human epithelial breast cancer cell line. see pmid: 17004106 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Biton S., Ashkenazi A. Apoptosis - Interactions involving proteins with a function related to apoptosis aa@gene.com Cell (0092-8674) 2011 Only protein-protein interactions imex curation biton-2011-4 NEMO and RIP1 control cell fate in response to extensive DNA damage via TNF-α feedforward signaling. human-rko Homo sapiens colorectal carcinoma cell line rko Human colorectal carcinoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Biton S., Ashkenazi A. Apoptosis - Interactions involving proteins with a function related to apoptosis aa@gene.com Cell (0092-8674) 2011 Only protein-protein interactions imex curation fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS ripk1_human Receptor-interacting serine/threonine-protein kinase 1 RIPK1 RIP Cell death protein RIP RIP1 Receptor-interacting protein 1 protein protein human Homo sapiens Human MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEALLEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMCIKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEEDVKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD nemo_human NF-kappa-B essential modulator IKBKG FIP3 NEMO NF-kappa-B essential modifier Inhibitor of nuclear factor kappa-B kinase subunit gamma IkB kinase-associated protein 1 FIP-3 protein protein human Homo sapiens Human MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE ripk1-fadd-2 1158654 n/a 1158658 unspecified role unspecified role prey prey n/a 1158659 unspecified role unspecified role bait bait physical association physical association false false false Supp. Fig. 1D Cells were treated for 20 hr with 100 uM etoposide. zVAD-fmk pan-caspase inhibitor etoposide casp8-fadd-5 1158654 n/a 1158660 unspecified role unspecified role bait bait n/a 1158658 unspecified role unspecified role prey prey n/a 1158659 unspecified role unspecified role prey prey association association false false false Figs. 1D, 1F, 1H, 2F, 2I, 3E, 3I, 4D, 4I, 5F, 6J, 6O Supp. Figs. 1H, 2A, 4C, 4H, 5H, 5J, 6F 50-100 uM etoposide. BMS-345541, IKK inhibitor Ku-55933, ATM inhibitor Necrostatin1 , RIP1-specific inhibitor BV6, bivalent IAP antagonist A soluble TNFR1-Fc decoy receptor Interaction inhibited by siRNA depletion of TNFR1 or by anti-TNF-α neutralizing antibody zVAD, pan-Capsase inhibitor fadd-ripk1-4 1158654 n/a 1158659 unspecified role unspecified role prey prey n/a 1158658 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1I Cells were treated for 20 hr with 100 uM etoposide. zVAD-fmk pan-caspase inhibitor etoposide ikbkg-ripk1-3 1158654 n/a 1158661 unspecified role unspecified role bait bait n/a 1158659 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1C, 1E, 5E Etoposide (0-25um) ikbkg-fadd 1158654 n/a 1158659 unspecified role unspecified role prey prey n/a 1158661 unspecified role unspecified role bait bait n/a 1158658 unspecified role unspecified role prey prey association association false false false Fig. 1E, 1G, 2E, 3D, 3H, 4C, 4H, 6I, 6N, Supp Fig. 5N Etoposide (50-100um) zVAD-fmk (pan-Caspase inhibitor) Ku-55933, ATM inhibitor BMS-345541, IKK inhibitor Interaction inhibited by siRNA depletion of TNFR1 or by anti-TNF-α neutralizing antibody. The RIP1-specific inhibitor Necrostatin1 did not block RIPK1 association with IKBKG but did prevent association of FADD with IKBKG and RIPK1. A soluble TNFR1-Fc decoy receptor casp8-fadd-7 1158655 n/a 1158658 unspecified role unspecified role prey prey n/a 1158660 unspecified role unspecified role bait bait n/a 1158659 unspecified role unspecified role prey prey association association false false false Fig S5F 50-100 uM etoposide. Necrostatin1 , RIP1-specific inhibitor casp8-ripk1-4 1158655 n/a 1158660 unspecified role unspecified role bait bait n/a 1158659 unspecified role unspecified role prey prey physical association physical association false false false Supp. Fig. 2C casp8-ripk1-5 1158656 n/a 1158660 unspecified role unspecified role bait bait n/a 1158659 unspecified role unspecified role prey prey physical association physical association false false false Supp. Fig. 2C casp8-fadd-6 1158657 n/a 1158659 unspecified role unspecified role prey prey n/a 1158658 unspecified role unspecified role prey prey n/a 1158660 unspecified role unspecified role bait bait association association false false false Fig S2F 50-100 uM etoposide.