IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ smith-2011-1 Noxa/Bcl-2 protein interactions contribute to bortezomib resistance in human lymphoid cells. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Smith A.J., Dai H., Correia C., Takahashi R., Lee S.H., Schmitz I., Kaufmann S.H. Apoptosis - Interactions involving proteins with a function related to apoptosis Kaufmann.scott@mayo.edu J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation smith-2011-2 Noxa/Bcl-2 protein interactions contribute to bortezomib resistance in human lymphoid cells. human-jurkat Homo sapiens jurkat Human T cell leukemia pull down pull down western blot western blot Immuno blot Immuno blot Smith A.J., Dai H., Correia C., Takahashi R., Lee S.H., Schmitz I., Kaufmann S.H. Apoptosis - Interactions involving proteins with a function related to apoptosis Kaufmann.scott@mayo.edu J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation smith-2011-4 Noxa/Bcl-2 protein interactions contribute to bortezomib resistance in human lymphoid cells. human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 pull down pull down western blot western blot Immuno blot Immuno blot Smith A.J., Dai H., Correia C., Takahashi R., Lee S.H., Schmitz I., Kaufmann S.H. Apoptosis - Interactions involving proteins with a function related to apoptosis Kaufmann.scott@mayo.edu J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation smith-2011-3 Noxa/Bcl-2 protein interactions contribute to bortezomib resistance in human lymphoid cells. human-rl Homo sapiens rl human B cell lymphoma RL cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Smith A.J., Dai H., Correia C., Takahashi R., Lee S.H., Schmitz I., Kaufmann S.H. Apoptosis - Interactions involving proteins with a function related to apoptosis Kaufmann.scott@mayo.edu J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation apr_human Phorbol-12-myristate-13-acetate-induced protein 1 NOXA Immediate-early-response protein APR PMAIP1 Protein Noxa protein protein human Homo sapiens Human MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT p10415-1 Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK pmaip1-bcl2-2 1174368 n/a 1174372 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false s-peptide tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1174373 unspecified role unspecified role prey prey purified purified P10415-1:p.[Pro59Thr;Ser117Arg] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false About 45e-8M, inferred from graphical representation (fig. 1e). gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P10415-1:p.[Asp31His;Ala60Val] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false 11e-9M P10415-1:p.[Ile48Phe;Arg129Cys] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false About 15e-8M (inferred from graph, fig 1e). ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1174368 1b, 1d, s1b, S1c and 1e pmaip1-mcl1-6 1174368 n/a 1174372 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false s-peptide tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1174374 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1174368 1a pmaip1-bcl2l1 1174368 n/a 1174372 unspecified role unspecified role bait bait purified purified s-peptide tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1174375 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1174368 S1a pmaip1-bcl2-1 1174368 n/a 1174372 unspecified role unspecified role bait bait purified purified bh3 domain containing region sufficient to bind sufficient binding region sufficient to bind exp feature detect experimental feature detection exp feature detect certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1174373 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P10415-1:p.Arg146Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2a and 2d bcl2-pmaip1 1174369 n/a 1174373 unspecified role unspecified role bait bait P10415-1:p.[Asp31His;Ala60Val] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false s-peptide tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1174372 unspecified role unspecified role prey prey physical association physical association false false false 3c and 3e Proteasome-inhibitor bortemozid is required for the interaction to take place. pmaip1-bcl2-1 1174369 n/a 1174376 unspecified role unspecified role prey prey n/a 1174372 unspecified role unspecified role bait bait s-peptide tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 3d Proteasome inhibitor MG132 is required for the interaction to take place. bcl2-pmaip1-2 1174370 n/a 1174376 unspecified role unspecified role bait bait s-peptide tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1174372 unspecified role unspecified role prey prey physical association physical association false false false 3g (right) Camptothecin, a topoisomerase I poison that induces apoptosis, was required for the interaction to take place. mcl1-pmaip1 1174370 n/a 1174372 unspecified role unspecified role prey prey n/a 1174374 unspecified role unspecified role bait bait s-peptide tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 3g (left) Camptothecin, a topoisomerase I poison that induces apoptosis, was required for the interaction to take place. bcl2-pmaip1-1 1174371 n/a 1174376 unspecified role unspecified role bait bait n/a 1174372 unspecified role unspecified role prey prey physical association physical association false false false 3f