MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint iwasawa-2011-1 Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Iwasawa R., Mahul-Mellier A.L., Datler C., Pazarentzos E., Grimm S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of proteins used for tagged constructs inferrred from author's email. s.grimm@imperial.ac.uk EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation iwasawa-2011-2 Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Iwasawa R., Mahul-Mellier A.L., Datler C., Pazarentzos E., Grimm S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of proteins used for tagged constructs inferrred from author's email. s.grimm@imperial.ac.uk EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation iwasawa-2011-3 Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Iwasawa R., Mahul-Mellier A.L., Datler C., Pazarentzos E., Grimm S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of proteins used for tagged constructs inferrred from author's email. s.grimm@imperial.ac.uk EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation iwasawa-2011-4 Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Iwasawa R., Mahul-Mellier A.L., Datler C., Pazarentzos E., Grimm S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of proteins used for tagged constructs inferrred from author's email. s.grimm@imperial.ac.uk EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation bap31_human B-cell receptor-associated protein 31 BCAP31 BAP31 p28 6C6-AG tumor-associated antigen DXS1357E Protein CDM protein protein human Homo sapiens Human MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE fis1_human Mitochondrial fission 1 protein FIS1 TTC11 FIS1 homolog Tetratricopeptide repeat protein 11 CGI-135 protein protein human Homo sapiens Human MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD bcap31-fis1 1022617 n/a 1022621 unspecified role unspecified role bait bait n/a 1022622 unspecified role unspecified role prey prey physical association physical association false false false 2a fis1-bcap31 1022617 n/a 1022621 unspecified role unspecified role prey prey n/a 1022622 unspecified role unspecified role bait bait physical association physical association false false false 2a fis1-bcap31-4 1022617 n/a 1022622 unspecified role unspecified role bait bait n/a 1022623 unspecified role unspecified role prey prey n/a 1022621 unspecified role unspecified role prey prey association association false false false 4a Casp8 binding depends on apoptosis induction using actinomycin D or etoposide. casp8-bcap31-3 1022617 n/a 1022622 unspecified role unspecified role ancillary ancillary n/a 1022623 unspecified role unspecified role bait bait n/a 1022621 unspecified role unspecified role prey prey physical association physical association false false false 4d Casp8 binding depends on apoptosis induction using actinomycin D or etoposide. fis1-bcap31-1 1022618 n/a 1022622 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1022621 unspecified role unspecified role prey prey p20bap31 fragment sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2b bcap31-fis1-1 1022618 n/a 1022622 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1022621 unspecified role unspecified role bait bait p20bap31 fragment sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2b fis1-bcap31-3 1022618 n/a 1022621 unspecified role unspecified role prey prey bap31 del vded domain sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis range range certain certain sequence position certain false certain certain sequence position certain range range false flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1022622 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4b bcap31-fis1-3 1022618 n/a 1022621 unspecified role unspecified role bait bait bap31 del vded domain sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis range range certain certain sequence position certain false certain certain sequence position certain range range false flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1022622 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4b bcap31-fis1-2 1022619 n/a 1022622 unspecified role unspecified role neutral component neutral component ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1022621 unspecified role unspecified role neutral component neutral component myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false S2c casp8-bcap31-1 1022620 n/a 1022621 unspecified role unspecified role prey prey vded domain required to bind necessary binding region required to bind mutation analysis mutation analysis range range range range false flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1022623 unspecified role unspecified role bait bait physical association physical association false false false 4c Casp8 binding depends on apoptosis induction using actinomycin D or etoposide.