IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ jamil-2010-1 Prevention of cytokine withdrawal-induced apoptosis by Mcl-1 requires interaction between Mcl-1 and Bim. mouse-fdcp-1 Mus musculus bone marrow fdcp-1 long-term bone marrow culture of mice anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jamil S., Wang S.W., Bondy L., Mojtabavi S., Duronio V. Apoptosis - Interactions involving proteins with a function related to apoptosis vduronio@interchange.ubc.ca Biochem. Cell Biol. (0829-8211) 2010 Only protein-protein interactions imex curation jamil-2010-2 Prevention of cytokine withdrawal-induced apoptosis by Mcl-1 requires interaction between Mcl-1 and Bim. mouse-bmm mouse bone marrow derived macrophages bmm bone marrow derived macrophages Bone marrow derived macrophages (BMM) were generated in vitro from precursor cells harvested from the femurs of C57BL/6 mice (7�8 weeks) by proliferation and differentiation in the presence of L-cell conditioned medium. as a source of CSF-1 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jamil S., Wang S.W., Bondy L., Mojtabavi S., Duronio V. Apoptosis - Interactions involving proteins with a function related to apoptosis vduronio@interchange.ubc.ca Biochem. Cell Biol. (0829-8211) 2010 Only protein-protein interactions imex curation b2l11_mouse Bcl-2-like protein 11 Bcl2-interacting mediator of cell death Bcl2l11 Bim protein protein mouse Mus musculus Mouse MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR mcl1_mouse Induced myeloid leukemia cell differentiation protein Mcl-1 homolog Bcl-2-related protein EAT/mcl1 Mcl1 protein protein mouse Mus musculus Mouse MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR mcl1-bcl2l11-1 1189130 n/a 1189132 unspecified role unspecified role prey prey n/a 1189133 unspecified role unspecified role bait bait Q07820:p.Thr163Glu mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3a Deprivation of growth factor IL3 (apoptosis-inducing conditions) increases the interaction. mcl1-bcl2l11-2 1189131 n/a 1189132 unspecified role unspecified role prey prey n/a 1189134 unspecified role unspecified role bait bait physical association physical association false false false 5b and 5c