InnateDB InnateDB he-2010a-1 The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. human-b-cell Homo sapiens B cell b-cell B-cell [B lymphocyte; B-lymphocyte; B cell; B-cells] pull down pull down western blot western blot Immuno blot Immuno blot He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Nat. Immunol. (1529-2908) 2010 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity he-2010a-8 The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. human-b-cell Homo sapiens B cell b-cell B-cell [B lymphocyte; B-lymphocyte; B cell; B-cells] confocal microscopy confocal microscopy immunostaining immunostaining He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis primary naive B cells were cultured for 15min with medium (ctrl) or APRIL before performing the confocal microscopy. Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Nat. Immunol. (1529-2908) 2010 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity he-2010a-2 The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down anti tag western anti tag western blot anti tag western He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Nat. Immunol. (1529-2908) 2010 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity he-2010a-3 The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. human-b-cell Homo sapiens B cell b-cell B-cell [B lymphocyte; B-lymphocyte; B cell; B-cells] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis experiment used 2E2 cell line, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Nat. Immunol. (1529-2908) 2010 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity he-2010a-4 The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Nat. Immunol. (1529-2908) 2010 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity he-2010a-5 The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. in vitro In vitro pull down pull down autoradiography autoradiography He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Nat. Immunol. (1529-2908) 2010 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity he-2010a-6 The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. human-b-cell Homo sapiens B cell b-cell B-cell [B lymphocyte; B-lymphocyte; B cell; B-cells] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Nat. Immunol. (1529-2908) 2010 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity he-2010a-7 The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. mouse-b-cell Mus musculus B-cell b-cell B-cell [B lymphocyte; B-lymphocyte; B cell; B-cells] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis primary naive B cells were cultured for with 0, 5, 15mins APRIL before performing the endogenous CoIP. Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Nat. Immunol. (1529-2908) 2010 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity he-2010a-9 The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. mouse-b-cell Mus musculus B-cell b-cell B-cell [B lymphocyte; B-lymphocyte; B cell; B-cells] confocal microscopy confocal microscopy immunostaining immunostaining He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Nat. Immunol. (1529-2908) 2010 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity he-2010a-10 The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip anti tag western anti tag western blot anti tag western He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis GST-TACI was IP out, author did not specify whether the IP Ab recognize GST or TACI. Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Nat. Immunol. (1529-2908) 2010 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity he-2010a-11 The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. human-b-cell Homo sapiens B cell b-cell B-cell [B lymphocyte; B-lymphocyte; B cell; B-cells] coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis GST-TACI was IP out, author did not specify whether the IP Ab recognize GST or TACI. Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Nat. Immunol. (1529-2908) 2010 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity traf5_human TNF receptor-associated factor 5 RING finger protein 84 TRAF5 RNF84 protein protein human Homo sapiens Human MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDLTDLEDL tr13b_human Tumor necrosis factor receptor superfamily member 13B Transmembrane activator and CAML interactor TNFRSF13B TACI protein protein human Homo sapiens Human MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLVAVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA myd88_human Myeloid differentiation primary response protein MyD88 MYD88 protein protein human Homo sapiens Human MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP camlg_human Guided entry of tail-anchored proteins factor CAMLG CAMLG CAML Calcium signal-modulating cyclophilin ligand GET2 protein protein human Homo sapiens Human MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGSEVP traf6_human TNF receptor-associated factor 6 TRAF6 RNF85 Interleukin-1 signal transducer RING finger protein 85 E3 ubiquitin-protein ligase TRAF6 RING-type E3 ubiquitin transferase TRAF6 protein protein human Homo sapiens Human MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV traf2_human TNF receptor-associated factor 2 TRAF2 TRAP3 Tumor necrosis factor type 2 receptor-associated protein 3 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein human Homo sapiens Human MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL tnr17_human Tumor necrosis factor receptor superfamily member 17 B-cell maturation protein TNFRSF17 BCM BCMA protein protein human Homo sapiens Human MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLEYTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKSISAR tnr5_human Tumor necrosis factor receptor superfamily member 5 CD40L receptor B-cell surface antigen CD40 Bp50 CDw40 CD40 TNFRSF5 protein protein human Homo sapiens Human MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ irak1_human Interleukin-1 receptor-associated kinase 1 IRAK1 IRAK protein protein human Homo sapiens Human MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSSIPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRLHCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAGQRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDPRPGPCPPELGLGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPPSPQENSYVSSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS irak4_human Interleukin-1 receptor-associated kinase 4 Renal carcinoma antigen NY-REN-64 IRAK4 protein protein human Homo sapiens Human MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS irak4_mouse Interleukin-1 receptor-associated kinase 4 Irak4 protein protein mouse Mus musculus Mouse MNKPLTPSTYIRNLNVGILRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTCELLFDWGTTNCTVGDLVDLLVQIELFAPATLLLPDAVPQTVKSLPPREAATVAQTHGPCQEKDRTSVMPMPKLEHSCEPPDSSSPDNRSVESSDTRFHSFSFHELKSITNNFDEQPASAGGNRMGEGGFGVVYKGCVNNTIVAVKKLGAMVEISTEELKQQFDQEIKVMATCQHENLVELLGFSSDSDNLCLVYAYMPNGSLLDRLSCLDGTPPLSWHTRCKVAQGTANGIRFLHENHHIHRDIKSANILLDKDFTAKISDFGLARASARLAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLELITGLAAVDENREPQLLLDIKEEIEDEEKTIEDYTDEKMSDADPASVEAMYSAASQCLHEKKNRRPDIAKVQQLLQEMSA tr13b_mouse Tumor necrosis factor receptor superfamily member 13B Tnfrsf13b Taci Transmembrane activator and CAML interactor protein protein mouse Mus musculus Mouse MAMAFCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYCTLGVCLCAIFCCFLVALASFLRRRGEPLPSQPAGPRGSQANSPHAHRPVTEACDEVTASPQPVETCSFCFPERSSPTQESAPRSLGIHGFAGTAAPQPCMRATVGGLGVLRASTGDARPAT traf6_mouse TNF receptor-associated factor 6 RING-type E3 ubiquitin transferase TRAF6 Traf6 E3 ubiquitin-protein ligase TRAF6 protein protein mouse Mus musculus Mouse MSLLNCENSCGSSQSSSDCCAAMAASCSAAVKDDSVSGSASTGNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIEDCPRRQVSCVNCAVSMAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPIPCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPEDPNYEETIKQLESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLEDKVAEMEAQQCNGIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQGTFIKDDTLLVRCEVSTRFDMGGLRKEGFQPRSTDAGV traf5_mouse TNF receptor-associated factor 5 Traf5 protein protein mouse Mus musculus Mouse MAHSEEQAAVPCAFIRQNSGNSISLDFEPDTEYQFVEQLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHEENSCPAYPVSCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLEKNYQLEQRISDLYQSLEQKESKIQQLAETVKKFEKELKQFTQMFGRNGTFLSNVQALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDLTDLEDL myd88_mouse Myeloid differentiation primary response protein MyD88 Myd88 protein protein mouse Mus musculus Mouse MSAGDPRVGSGSLDSFMFSIPLVALNVGVRRRLSLFLNPRTPVAADWTLLAEEMGFEYLEIRELETRPDPTRSLLDAWQGRSGASVGRLLELLALLDREDILKELKSRIEEDCQKYLGKQQNQESEKPLQVARVESSVPQTKELGGITTLDDPLGQTPELFDAFICYCPNDIEFVQEMIRQLEQTDYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGVQQKRLIPIKYKAMKKDFPSILRFITICDYTNPCTKSWFWTRLAKALSLP camlg_mouse Guided entry of tail-anchored proteins factor CAMLG Camlg Caml Calcium signal-modulating cyclophilin ligand Get2 protein protein mouse Mus musculus Mouse MEPVPAATDGGERPATPSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGSEEENQTKSKPQDSDKLNSLSIPSVSKRVVLGDSVDGGGADQLGGVAEVRGTQLGDKLDSFIKAPECSSKDGAELRQRTRGDLTADPAQRASHHGLEQYLSRFEEAMKLRKQLISEKPSQEDGSTAEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKGEKKVKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGPEVP traf2_mouse TNF receptor-associated factor 2 Traf2 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein mouse Mus musculus Mouse MAAASVTSPGSLELLQPGFSKTLLGTRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL camlg-myd88 1130377 n/a 1130388 unspecified role unspecified role prey prey n/a 1130389 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1130390 unspecified role unspecified role prey prey n/a 1130391 unspecified role unspecified role prey prey n/a 1130392 unspecified role unspecified role prey prey n/a 1130393 unspecified role unspecified role prey prey association association false false false Fig. 2A, 4B, 4E deletion and mutation for Myd88 interaction: region required to bind=226-239; TACI mutation-decreasing= Glu228Arg, Thr229Arg, Ser231Arg, Cys233Gly tnfrsf17-traf5 1130377 n/a 1130388 unspecified role unspecified role prey prey n/a 1130394 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1130392 unspecified role unspecified role prey prey association association false false false Fig. 2A cd40-myd88 1130377 n/a 1130395 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1130392 unspecified role unspecified role prey prey n/a 1130388 unspecified role unspecified role prey prey n/a 1130393 unspecified role unspecified role prey prey association association false false false Fig. 2A tnfrsf13b-irak1 1130377 n/a 1130396 unspecified role unspecified role prey prey n/a 1130389 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1130390 unspecified role unspecified role prey prey association association false false false Fig. 5E (left) tnfrsf13b-irak4 1130377 n/a 1130389 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1130397 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5E (right) traf2-myd88-1 1130378 n/a 1130393 unspecified role unspecified role neutral component neutral component n/a 1130390 unspecified role unspecified role neutral component neutral component n/a 1130389 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 2F polarized membrane patches of colocalized proteins were only present when B cells are stimulated with APRIL traf6-myd88-1 1130378 n/a 1130389 unspecified role unspecified role neutral component neutral component n/a 1130390 unspecified role unspecified role neutral component neutral component n/a 1130392 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. S5A, polarized membrane patches of colocalized proteins were only present when B cells are stimulated with APRIL camlg-myd88-1 1130378 n/a 1130390 unspecified role unspecified role neutral component neutral component n/a 1130389 unspecified role unspecified role neutral component neutral component n/a 1130391 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Supp. Fig. 5B polarized membrane patches of colocalized proteins were only present when B cells are stimulated with APRIL tnfrsf13b-myd88 1130379 n/a 1130389 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1130390 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2B tnfrsf13b-myd88-1 1130379 n/a 1130389 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1130390 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5B tnfrsf13b-myd88-2 1130380 n/a 1130389 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1130390 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2C (lane 2) camlg-traf5 1130380 n/a 1130388 unspecified role unspecified role prey prey n/a 1130391 unspecified role unspecified role bait bait n/a 1130392 unspecified role unspecified role prey prey association association false false false Fig. S9B. myd88-tnfrsf13b 1130381 n/a 1130390 unspecified role unspecified role bait bait n/a 1130389 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2C (lane 4) tnfrsf13b-myd88-3 1130382 n/a 1130390 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 1130389 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false Fig. 2D tnfrsf13b-myd88-4 1130383 n/a 1130389 unspecified role unspecified role bait bait n/a 1130390 unspecified role unspecified role prey prey n/a 1130393 unspecified role unspecified role prey prey association association false false false Fig. 2E APRIL treatment for 15mins doubled the amount of myd88 IP out camlg-irak4 1130384 n/a 1130398 unspecified role unspecified role prey prey n/a 1130399 unspecified role unspecified role bait bait n/a 1130400 unspecified role unspecified role prey prey n/a 1130401 unspecified role unspecified role prey prey n/a 1130402 unspecified role unspecified role prey prey n/a 1130403 unspecified role unspecified role prey prey n/a 1130404 unspecified role unspecified role prey prey association association false false false Fig. 3A APRIL 5-15mins myd88-tr13b 1130385 n/a 1130399 unspecified role unspecified role neutral component neutral component n/a 1130404 unspecified role unspecified role neutral component neutral component n/a 1130402 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 3B polarized membrane patches of colocalized proteins were only present when B cells are stimulated with APRIL tnfrsf13b-myd88-5 1130386 n/a 1130390 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1130389 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. S4 camlg-myd88-3 1130387 n/a 1130391 unspecified role unspecified role prey prey n/a 1130389 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1130393 unspecified role unspecified role prey prey n/a 1130390 unspecified role unspecified role prey prey n/a 1130388 unspecified role unspecified role prey prey n/a 1130392 unspecified role unspecified role prey prey association association false false false Fig. S10B. ser194xaa mutation in TACI decreased the interaction with Myd88 only.