IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ shen-2009-2 Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 31 imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation shen-2009-1 Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 31 imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation shen-2009-4 Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 31 imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation shen-2009-5 Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 31 imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation shen-2009-3 Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column anti tag western anti tag western blot anti tag western Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 31 imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation shen-2009-6 Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. mouse-erythroleukemia Mus musculus me17-1 Murine erythroid cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 31 imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation shen-2009-7 Jumonji modulates polycomb activity and self-renewal versus differentiation of stem cells. mouse-f9 Mus musculus f9 Mouse F9 129 embryo teratocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shen X., Kim W., Fujiwara Y., Simon MD., Liu Y., Mysliwiec MR., Yuan GC., Lee Y., Orkin SH. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of transfected proteins taken from PMID: 19026780. Biotinylated EED2 and EZH2 further identified by molecular weight. stuart_orkin@dfci.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 31 imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation mtf2_mouse Metal-response element-binding transcription factor 2 Mtf2 Pcl2 Zinc-regulated factor 1 Metal-response element DNA-binding protein M96 Metal regulatory transcription factor 2 Polycomb-like protein 2 protein protein mouse Mus musculus Mouse MRDSTGAGNSLVHKRSPLRRNQKTSASLNKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNVAFKAEKEPEGTSHEFKIKGRKASKPTSDSREVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAELPLDKESVSENPTLDLPCSIGRTEGIAHSSNTSDVDLTGASSANETTSASISRHCGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEVVKDDEGKEDYQFEELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS jard2_mouse Protein Jumonji Jumonji/ARID domain-containing protein 2 Jarid2 Jmj protein protein mouse Mus musculus Mouse MSKERPKRNIIQKKYDDSDGIPWSEERVVRKVLYLSLKEFKNAQKRQHGEGLAGSLKAVNGLLGNAQAKALGPASEQSENEKDDASQVSSTSNDVSSSDFEEGPSRKRPRLQAQRKFAQSQPNSPSTTPVKIVEPLLPPPATQISDLSKRKPKTEDFLTFLCLRGSPALPNSMVYFGSSQDEEDVEEEDDETEDVKATTNNASSSCQSTPRKGKTHKHVHNGHVFNGSSRSAREKEPAHKHRSKEATPGKEKHSEPRADSRREQASGAQPTAASAAASSAKGLAANHQPPPSHRSAQDLRKQVSKVNGVTRMSSLGAGTNSAKKIREVRPSPSKTVKYTATVTKGTVTYTKAKRELVKETKPNHHKPSSAVNHTISGKTESSNAKTRKQVLSLGGASKSTGPAASGLKASSRLNPKSCTKEVGGRQLREGLRNSKRRLEEAQQVDKPQSPPKKMKGVAGNAEAPGKKASAASGEKSLLNGHVKKEVPERSLERNRPKRAAAGKNMLGKQAHGKTEGTPCENRSTSQPESSHKPHDPQGKPEKGSGKSGWAAMDEIPVLRPSAKEFHDPLIYIESVRAQVEKYGMCRVIPPPDWRPECKLNDEMRFVTQIQHIHKLGRRWGPNVQRLACIKKHLRSQGITMDELPLIGGCELDLACFFRLINEMGGMQQVTDLKKWNKLADMLRIPKTAQDRLAKLQEAYCQYLLSYDSLSPEEHRRLEKEVLMEKEILEKRKGPLEGHTESDHHKFHSLPRFEPKNGLVHGVTPRNGFRSKLKEVGRAPLKTGRRRLFAQEKEVVKEEEEDKGVLNDFHKCIYKGRSVSLTTFYRTARNIMNMCFSKEPAPAEIEQEYWRLVEEKDCHVAVHCGKVDTNTHGSGFPVGKSEPFSRHGWNLTVLPNNTGSILRHLGAVPGVTIPWLNIGMVFSTSCWSRDQNHLPYIDYLHTGADCIWYCIPAEEENKLEDVVHTLLQGNGTPGLQMLESNVMISPEVLCKKGIKVHRTVQQSGQFVVCFPGSFVSKVCCGYNVSETVHFATTQWTSMGFETAKEMKRRHIAKPFSMEKLLYQIAQAEAKKENGPTLSTISALLDELRDTELRQRRLLFEAGLHSSARYGSHDGNSTVADGKKKPRKWLQLETSERRCQICQHLCYLSMVVQENENVVFCLECALRHVEKQKSCRGLKLMYRYDEEQIISLVNQICGKVSGKHGGIENCLNKPTPKRGPRKRATVDVPPSRLPSS eed_mouse Polycomb protein EED Eed protein protein mouse Mus musculus Mouse MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR ezh2_mouse Histone-lysine N-methyltransferase EZH2 Ezh2 Enx1h Enhancer of zeste homolog 2 ENX-1 protein protein mouse Mus musculus Mouse MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKTMFSSNRQKILERTETLNQEWKQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPAQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPDEREEKQKDLEDNRDDKETCPPRKFPADKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTISVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPVPTEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP ezh1_mouse Histone-lysine N-methyltransferase EZH1 Ezh1 Enx2 Enhancer of zeste homolog 1 ENX-2 protein protein mouse Mus musculus Mouse MDIASPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEWKKLRVQPVQPMKPVSGHPFLKKCTIESIFPGFDSQDMLMRSLNTVALVPIMYSWSPLQQNFMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELVDALNQYSDEEEDGHNDPSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIFSAIASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGRRRRRHPVVSASCSNASASAMAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASPAPAQLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLILKLPTDELMNPAQKKKRKHRLWAAHCRKIQLKKDNNSTQVYNYQPCDHPDRPCDSTCPCIMTQNFCEKFCQCSPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVVSCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQAGEELFFDYRYSQADALKYVGIERETDVF stk38_mouse Serine/threonine-protein kinase 38 Stk38 Ndr1 NDR1 protein kinase Nuclear Dbf2-related kinase 1 protein protein mouse Mus musculus Mouse MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPVSEKAKGLILRFCCEWEHRIGAPGVEEIKNNLFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVTTSSHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK rbbp7_mouse Histone-binding protein RBBP7 Rbbp7 Rbap46 Retinoblastoma-binding protein 7 Retinoblastoma-binding protein p46 Histone acetyltransferase type B subunit 2 Nucleosome-remodeling factor subunit RBAP46 protein protein mouse Mus musculus Mouse MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTASELEGQGS aebp2_mouse Zinc finger protein AEBP2 Aebp2 Adipocyte enhancer-binding protein 2 protein protein mouse Mus musculus Mouse MAAALADMADLEELSRLSPLSPGSPGPAARGRAEPPEEEEEEDDEEAEAEAVAALLLNGGAGGGAGGGEAETMSEPSPESASQAGGDEDEDEEDDEDEGSSSGGAEEESSAESLVGSSSGGCSGDETRSLSPGAASSSSGDGDGKEGLEEPKGPRGGPGGPGSSGGGSSSSSVVSSGGDEGYGTGGGGSSATSGGRRGSLEMSSDGEPLSRMDSEDSISSTLMDIDSTISSGRSTPAMMNGQGSTTASSKHIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEESGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKRFDILNFPR rbbp4_mouse Histone-binding protein RBBP4 Rbbp4 Rbap48 Retinoblastoma-binding protein 4 Retinoblastoma-binding protein p48 Chromatin assembly factor 1 subunit C Chromatin assembly factor I p48 subunit Nucleosome-remodeling factor subunit RBAP48 protein protein mouse Mus musculus Mouse MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS suz12_mouse Polycomb protein Suz12 Suz12 D11Ertd530e Kiaa0160 Suppressor of zeste 12 protein homolog protein protein mouse Mus musculus Mouse MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAAVAAAASGGKSGGGGCGGGGSYSASSSSAAAAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTSIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSQNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVSEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPVAKPLATRNSESLHQENKPGSVKPAQTIAVKETLTTELQTRKEKDNSNESRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESATPSNEEIAEEQNGTANGFSETNSKEKALETDGVSGVPKQSKKQKL q921e6-2 Polycomb protein EED Eed EED-1 protein protein mouse Mus musculus Mouse MAGSHARPPRRLGAICDSGGSGGGGGAGSFAAGSGRACLTAVWRRPRPRRQEPGGRRRNMSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR Translation initiates from a non-canonical start codon (GUG). q921e6-3 Polycomb protein EED Eed EED-4 protein protein mouse Mus musculus Mouse MPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR setx_mouse Probable helicase senataxin Setx Als4 Kiaa0625 SEN1 homolog Amyotrophic lateral sclerosis 4 protein homolog protein protein mouse Mus musculus Mouse MSTCCWCTPGGSSTIDVLKRYASSTGSSEFQTADEDLCYCLECVAEYHRARDEVPFLHEVLWELETLRLVSHFEKSMKAEAEDDDDLYIVDNNGEEQLFDCSGQDFENKLRVPLFEILKYPYLLLHERVNELCVEALCRMEQNNCSFQVFDKYPGIYLFLVHPNEMVRRWAILTARNLGKVDRDDYYDLQEVLTCLFKVIELGLLESPDIYTSSVLEKGKLILLPAHMYDTTNYKNYWLGICMLLTILEEQAMDSLLLGSDKQNDFMQSILHTMEKQSDDDSMDPFWPALHCFMVILDRLGSKVWGQLIDPIEAFQTIINNESYNREIQNIRNSSIRTKLEPEPHFDDMVTCSQIVYNFNPEKTKKDSGWRSAICPDYCPNMYEEMETLANVLQSDIGQDMRVHNSTFLWFIPFVQSLMDLKDLGVAYIVEVIHHLYSEVKDVLNQTDAVCDKVTEFFILILISVIELHRNKKCLHLLWVSSQQWVEAVVKCAKLPTTAFVRSCEKSPGSTSRGAAIMSSLALHSVQSNSVQLACVQLIRGLLKEGYQLGQQTLCKRFWDKLNLFLRGNLSLGWQLTGQETHELQMCLKQIIRNIKFKMPQYSTFGDSTSTFKTPPSFKEESDKIDRKHKKNIYCLENCSPVSSKEPMKADTHRVLMKVNTTEEENFKQHYIDLNEEEQEPLPAELCLKQKSEALFSESAQEQVKISAEKSGKESSSYAPSNSTSRNGPEWGCDRGVIMSAHSLTDSSSDFMEQVSTSNEDVSLKDGSVGKTSKPSFKLQKDEICAKLSHVIKKQIRKSTLVDNIIDLEENTAISDLENCSGTDGGALKEDSIGHNVPSDPVLDDKHEEQKSQNSSLFKKEIKSEELDNSSSDDEDKLQIQEGRADDDLVSFTEVTDTLVKAPCEGHVKMVVESRDKEMRESTALTSNLVEGQVPHDSSKPLVAGRQIDLCNITLISQTTVIQFPSGLSKQNSFQLQKGDKRCLTANQNSAATCRGQVIVISDSDEEEDEDEDERSSSEENIKQSKACIGKDCSEHRSLAVNASVEKQLVKEEERYPVEFEDSESQVFEFESSSEVFSVWQDHKIDSKNSLQGEQKSYVTHVADSTNNNLGCGDSVSEEVVRNKAEGVKEHAGPHSSVSAEEFCKTGVKKPKRKRYDKVTAEDPQRPSSSVGTDQLPDRRDLTESDLKSADMGMATPSSSVERDSTILQKSTKSRTHSKPVRKVPASKATKKTHSDTRRGQSKSSCYISCRTSPAIVPPKKLRQCPEPTSTVEKLGLKKAPRKAFELSQRSLECIVQLRDHGKTVGVVDAPKKAKLISPQTLSIKNNKKLLTSQDLQFQRLMRSRSHKKRDFDYKNTDTVRVSRIVQGSDVLEADSDEPDDHRVSEPLAISNEKQLAKCMLSKTEVAEASSDPWVTGITCLVNQCESRVLSGGVPTDVVMVSASEDPVDGGAVTVQVGEVASVKAAEPASSSDTDDDDNLFLTQHDPQDMDLCSQLENKTIIVAHKKDTVQREDSLSRPQLESLSITKCKYKDCVETTKNQGEYCPRHSEAKAADDGLFRKPGLPLSVARPLRPTTTKIFSSSSASRTANLSKSLESTTLQQSALKNKSSGAQPNLKVTPPSSMGSQKPVAEVKSLCNIFHFQTPSSSSKQSCKLTFSENRPTSAASPVNILLPSQSIFDTFIKEVLKWKYQMFLNFDKCGAPTSLCQSISRPVPVRFQDCAEYFNVFLPLIILNAFETVAQEWLSSPNKENFYQLQLRKFPADYKKYWEFLIYLNESELAKQLHPKENDLVFLAPEKSYMDRHGMQDCSHYYCGYVHKFRRTSVMRSGKAECSLCIQTQDTLPASVKNLTRCIVISSLVTTQRKLKAMSLLSSRNQLARAVLNPNPMDFCTKDLLTTTSERIVAYLKDFNEDQKKAIETAYAMVKHSPSVAKICLIHGPPGTGKSKTIVGLLYRLLTENQRKGHSDENFNAKIKQNRVLVCAPSNAAVDELMKKIILEFKEKCKDKKNPLGNCGDINLVRLGPEKSINTEVLKFSLDSQVNHRMKKDLPSHIQEMLRRKEILDAQLDELSRQRALCRGGREMQRQELDEHIAIVSKERQELASKIKEVQGRPQRAQNTIILESHVICCTLSTSGGLLLESAFRGQGGVPFSCVIVDEAGQSCEVETLSPLIHRCNKLILVGDPKQLPPTVISMKAQEYGYDQSMMARFCKLLEENVEQNMIGRLPVLQLTIQYRMHPDICLFPSNYVYNKNLKTNRLTESIRCSSEWPFQPYLVFDVGDGSERRDNDSYINVQEIKLVMEIIKLIKEKRKDISFRNIGIITHYKAQKTMIQKDLEKEFDKKGPAEVDTVDAFQGRQKDCIIVTCVRASAVQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENQHWYELIQDAQKRGAIIKTSDPNYRHDAMKILKLKPVLQRSLTHPPATAPEAPRPQGGLPSNRLDSGLATTSFAASLYHTPSDTVTSKGPERPLLQDRLRDPRLLRRLDAEAKGTFLKDPQPVSPQLPGVVHLLGEPGFPVVFQDLGFVVPPSTAIVAPLGSHRSPMQAEPPPAHPAAAASTSKRKYSDPDAGLSHKREPRAFSGEQGRHGSVTHHVLRSTDWDRRRLDDSSAKRRQFL morc3_mouse MORC family CW-type zinc finger protein 3 Morc3 Zcwcc3 Nuclear matrix protein 2 Nxp2 Zinc finger CW-type coiled-coil domain protein 3 protein protein mouse Mus musculus Mouse MAAQPPTGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVISDHICLTFTDNGNGMTADKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAMVFTKNGETMSVGFLSQTYLEVIKAEHVVVPIVTFNKHRQMINLTESKASLAAILEHSLFSTEQKLLAELNAIMGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDETAGRKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIIIRGQKVKTQLVSKSLAYIERDVYRPKFLTRTVRITFGFNCRNKDHYGIMMYHKNRLIKAYEKVGCQLKANNMGVGVVGIIECNFLKPTHNKQDFDYTNEYRLTILALGEKLNDYWNEMKVKKNAEYPVNLPVEDIQKRPDQTWVQCDACLKWRKLPDGIDQLPEKWYCSNNPDPQFRNCEVPEEPEDEDLVHPTYEKTYKKTSKERFRIRQPEILPRILPQINPELLYQTSVSSQSFSPVKESVPRPHLSEVTSPFAARIINLNLASPASEPENSSMKRKLGVHSSILNAKTRRLSNPPVENSSYKNDDDEDVIILEENSTPKPAVDLEVKSDIEVKSEQSHTEQSGIHVDLVSSPKPCVQASSTSTSTSRSDPGITVSTQTDAPGLTVKKEESMEEDMGVRNGTATLSCVGTEAKVQETSAESVDATSHQLQELRSELLVVTQERDDYKRQCQMFTDQIQVLQQRLLEMNDKCVKKEKCHQSTETDAVFLLDSVNGQAESLDHLGSQYQQALQEIERLKRQCSALQQVKSECSQASCTESKSEVDEMAVQLDDVFRQLDKCTIERDQYKNEVQLLEIEKSHIHSQCEELQTEVEQLKSTGQQAAADGSTASNAEEPVSYVDGESLKLRSLRVNVGQLLAMIVPDLDLQQVNYDVDVVDEILGQVVEQMSEISST tri35_mouse E3 ubiquitin-protein ligase TRIM35 Trim35 Hls5 Kiaa1098 Mair Macrophage-derived apoptosis-inducing RBCC protein Protein Nc8 Hemopoietic lineage switch protein 5 protein protein mouse Mus musculus Mouse MEPGPSVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRRCVSGCWEVQTTPSCPVCKERAVPGELRTNHTLNNLVETLLREEAEGARWTGRRSPRPCRAHRAPLTLFCLEDKELLCCACQADARHQEHRVQPIKDTAQDFRAKCKNMEHVLREKAKAFWALRRTYEAIAKHNEVQTTWLEGRIRDEFDKLRDFLRVEEQATLDAMKEESRKKHLQAEEKMKQLAEQTEALAREIERLQMEMKEDDMTFLMKHKSRKRRLFCTVEPAPLQPGLLMDACKYLESLQYRVWKKMLGSVESVPFSLDPNTAAGWLKVADDLTSVINHGYRVQVENPERFSSAPCLLGSQVFSKGSHSWEVDVGGLPTWRVGVVRVQAHAQAQAQADVGGEGHSHSCYHDTRSGFWYLCRTQGVDGDHCMTSDTATAPLVQAMPRRLRVELECEEGELSFYDSERHCHLYTFHAHFGEVRPYFYLGASRGDGPPEPLRICHLRVSIKEELDI ice1_mouse Little elongation complex subunit 1 Ice1 Interactor of little elongator complex ELL subunit 1 Kiaa0947 protein protein mouse Mus musculus Mouse MMPGETHPAAPGPADLARCQGCASLQQNLNEYVEALIALKQKIINTDNLLTEYQKKCDELQFARRENSTLHHQVEQMLQKISPLQKCQEELGSLKAELEEKKSSLKLYQDTHQEYARVKEECLRTDAQKKKLEAKVKKLEEAAVKQTQDFKQLRNEKKILEKEFKKTQERLDEFSKQKNEKELRHIGTQISSDSHGSIDKRKVKVLLKELWLCVNTAHRLSGEGGRRIPEKPAKGSSAARASEQDELLPVQGGPARAADMRSFFSKLSMEMEGDFSSSESAEEELPSGASPSTEHAFCEERHSEVSGQRPDDGNRTNVYDHEHFFDDDLQAAIDFFKLPPPLLSPVPSPPPMASGSLPSSLAPESFFGEFTDSSDSDSVPPRDSMESALEDYTAESRAYFDLLEKIKRSDQYVKKPGSLEATQAVNSLTPLGFVTGRTALGEPSAAASLAQGRHWTESSEFVRDRGDSVEEAERMVEAREVDKSVQVGKGLLKHNRKLWLEMASRGPARKKEAGAGESEICFSSLGKRTFSELIESEGKTLSSKALCPSQSEFSKRTLTDGSASKSPCVTGSGRFQRRERDVRESTPQSGICAAAAGRGHSARLPSSSSATSVPVSVCSNHQTPWPGCVSVGTPAEGTCTEQKSPTRTLNTFLLRSEPTACFPKENDPENSLSTLSPKSKLGTSTFSDWKSRGLESFSTLKSTAKGHSLPQSVFPKPTGGGQCKGRGPGATLILPKSDWTSLARSQAGFTRRSSGSADSTSWHRSDVLRRGSGGSPRASSEYQQRTRLQLEKATPASQNSSLTAMHGPSGESTIPPESNAAAALLPNQVSVITKQARPRRVLGSSLEPWQPHGNTLSPAVNGGKETGLMPSVSACVGDGDPIAQVPEQIADKETPSPEVSVSWRNPICDSPSDSLLAENFSCSTDRKLPFSSEDNIFQCAMNEHLQQKPTKSPQTTQSGASRLEAGELLPSGVTSGVFPAEQVPHGPHHQADTEAPVVARESHSAPQNASAPPVVPSRGPLRARVPTVPVCPSSLSRAEEETQGTSQSSLPGASYCYTGIRERGEEDTEVEDEAVSCSEGEHEAEAVMGRRQQEQAEDSHRPLGDPEAGVGEAGHPSDVGDLTSALEECNLSTLLYIDKLSTSEVVMVLESCQLGDYSSRVSASECASKGSLSEEMNTELRQSEISRKKCGKRLWEEKLLRASEEWAESEGDDSCGRTSCQHAQCPLEVPSDVLTKTGEELDTNPVDCGGTDTEHALLESTHHSQAAEDLTEDALPEETSSPMPHTAELPDPSAVDGGGSSPLSSRSDPEHIQSSYEDEPNSGECLSIGEEGLAEPGELLTLSSDSSTPPRLEQSSDCVAETAFRYQISAVTSEVISVLINKDQDLVIEKGDNWTIISGVAISPGMEQVVLCDTLGDAASSQDQGGLDDGSMEKSPEASPSGPLPQEPPCGGDLSGAQEDISSNGQSANFDKSRLRNRPVKPSIWIRSQIYDQTLETEKVASDHTYYNWKLEPLGKNKPRSKISNKDQASKLAKTLVLNRGEVHLNEVPQPASGEGTNIKLPRSQAQPIMAGTDRSTPTNCSPDTLSKIRQEVGPPLPPLLPPLIATPPRSSQTLSPLVPNSGPSSRSSPAGHVSPLCEVPGPPVLSPWPEELQQASPLDPSPSPSTAAASGRIVSSPLQFCAATPKHALPVPGRLPSCAPGHAAVSGPQQENSVKILDTMYPELSARARTLSLLKGNMQLSRGSTVDGKVLPGRVSALLGLKAITSTSTAFVLTGGSSGADGSQGKSQDSGVQQDAGGKRTLAVSMLRSAKRLRLDNKSPEPDTREVTGEGVPEDPQGGSPLAEVVPAEEEQADVPVCSAASLLRVNPREMAESYNIAITRALRKIAESSFDLLPVIRSHVYVGNISKKPVMRDQEKEVVYEFSTTNKHLGEYLLRSILSELKIQKTSLDHSYIHALCRVYVGICRQLGDLERARLFCYSLLKEDFPESEKLTLFIANMWREVFLSQSAISEAMQLVARQRARGEVLNCLRAFLSWEKNAPIDVGIVVSKLLLTIQLCPKTEFQSSEEFGEDLSANIWEYIFAIDLLCCHQRWIWTHDNIISKELWPVMDKWIKYRKGHSNIAYTPDVIVASVLRLIGRLGQLGLKEGFPTAVKNISSVIGMFIQHAQDEDIPWGVQLAAVYALCDLSPSNPAEISKILEAWRTQTSNAIPSAIVHCLEEVGSLSADGSAGCTSKGDSAP st38l_mouse Serine/threonine-protein kinase 38-like Stk38l Ndr2 NDR2 protein kinase Nuclear Dbf2-related kinase 2 protein protein mouse Mus musculus Mouse MAMTAGATTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKADMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDVKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGFPPFCSETPQETYRKVMSWKETLAFPPEVPVSEKAKDLILRFCTDSENRIGNGGVEEIKGHPFFEGVDWGHIRERPAAIPIEIRSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL bclf1_mouse Bcl-2-associated transcription factor 1 Bclaf1 Btf Kiaa0164 protein protein mouse Mus musculus Mouse MGRSNSRSHSSRSKSRSQSSSRSRSRSHSRKKRYSSRSRSRTYSRSRSRDRIYSRDYRRDYRNNRGMRRPYGYRGRGRGYYQGGGGRYHRGGYRPVWNRRHSRSPRRGRSRSRSPKRRSVSSQRSRSRSRRSYRSSRSPRSSSSRSSSPYSKSPVSKRRGSQEKQTKKAEGEPQEESPLKSKSQEEPKDTFEHDPSESIDEFNKSATSGDIWPGLSAYDNSPRSPHSPSPIATPPSQSSSCSDAPMLSTVHSAKNTPSQHSHSIQHSPERSGSGSVGNGSSRYSPSQNSPIHHIPSRRSPAKTITPQNAPREESRGRSSFYPEGDQETAKTGKFLKRFTDEESRVFLLDRGNIRDKEAPKEKGSEKGRADGDWDDQEVLDYFSDKESAKQKFHDSEGDDTEETEDYRQFRKSVLADQGKSFATSSHRNTEEEGPKYKSKVSLKGNRESDGFREEKNYKLKETAYIVERPSTAKDKHKEEDKGSDRITVKKEVQSPEQVKSEKLKELFDYSPPLHKSLDAREKSIFREESPLRIKMIASDSHRPEVKLKMAPVPLDDSNRPASLTKDRLLASTLVHSVKKEQEFRSIFDHIKLPQANKSTSESFIQHIVSLVHHVKEQYFKSPAVTLNERFTSYQKATEEHSTRQKSPEIHRRIDISPSALRKHTRLAGEERGFKEEIQKGDKKLRCDSADLRHDIDRRRKERSKERGDSKGSRESSGSRKQEKTPKDYKEYKPYKDDSKHKGRERDHSRSSSSSASPSSPSSREEKESKKEREEEFKTHHEMKDYSGFAGVSRPRGTFFRIRGRGRARGVFAGTNTGPNNSNTTFQKRPKEEEWDPEYTPKSKKYFLHDDRDDGVDYWAKRGRGRGTFQRGRGRFNFKKSGSSPKWTHDKYQGDGIVEDDEETMENNEEKKDRRKEEKE tr150_mouse Thyroid hormone receptor-associated protein 3 Thrap3 Trap150 Thyroid hormone receptor-associated protein complex 150 kDa component protein protein mouse Mus musculus Mouse MSKTNKSKSGSRSSRSRSASRSRSRSFSKSRSRSRSVSRSRKRRLSSRSRSRSYSPAHNRERNHPRVYQNRDFRGHNRGYRRPYYFRGRNRGFYPWGQYNRGGYGNYRSNWQNYRQAYSPRRGRSRSRSPKRRSPSPRSRSHSRNSDKSSSDRSRRSSSSRSSSNHSRVESSKRKSTKEKKSSSKDSRPSQAAGDNQGDEAKEQTFSGGTSQDIKGSESSKPWPDATTYGAGSASRASVSDLSPRERSPALKSPLQSVVVRRRSPRPSPVPKPSPPLSNASQMGSSMSGGAGYQSGAHQGQFDHGSGSLSPSKKSPVGKSPPATGSAYGSSQKEESAASGGAAYSKRYLEEQKTENGKDKEQKQTNADKEKLKEKGGFSDADVKMKSDPFAPKTDSEKPFRGSQSPKRYKLRDDFEKKMADFHKEELDEHDKDKSKGRKEPEFDDEPKFMSKVIAGASKNQEEEKSGKWESLHTGKEKQRKAEEMEDEPFTERSRKEERGGSKRSESGHRGFVPEKNFRVTAYKAVQEKSSSPPPRKTSESRDKLGSKGDFSSGKSSFSITREAQVNVRMDSFDEDLARPSGLLAQERKLCRDLVHSNKKEQEFRSIFQHIQSAQSQRSPSELFAQHIVTIVHHVKEHHFGSSGMTLHERFTKYLKRGNEQEAAKNKKSPEIHRRIDISPSTFRKHGLTHEELKSPREPGYKAEGKYKDDPVDLRLDIERRKKHKERDLKRGKSRESVDSRDSSHSRERSTEKTEKTHKGSKKQKKHRRARDRSRSSSSSSQSSHSYKAEEYPEEAEEREESTSGFDKSRLGTKDFVGPNERGGRARGTFQFRARGRGWGRGNYSGNNNNNSNNDFQKRSREEEWDPEYTPKSKKYYLHDDREGEGSDKWMGRGRGRGAFPRGRGRFMFRKSSTSPKWAHDKFSGEEGEIEDDESGTENREEKDSLQPSAE ell_mouse RNA polymerase II elongation factor ELL Eleven-nineteen lysine-rich leukemia protein Ell protein protein mouse Mus musculus Mouse MAALKEARSYGLSCGRVSDGSRVSVFHVKLTDSALKAFESYRAHQDSVSLRPSIRFEGSQGHISIPQPDCPEEVRAFSFYLSNIGRDSPQGSFDCIQQYVSSYGDVHLDCLGSIQDKVTVCATDDSYQKARQSMAQAEEETRSRSAIVIKAGGRYMGKKVQFRKPAPGAADAVPSRKRATPINLASAIRKSSGSGASSVVQRPFRDRVLHLLALRPYRKAELLLRLQKDGLTQADKDTLDSLLQQVASVNPKDGTCTLQDCMYKSLQKDWPGYSEGDRQLLKRMLMRKLCQPQNATTDSSPPREHGRSASPSQKRPTDFIDPLASKKPRISHFTQRAQPTLNGKLGAPNGHETLLPAPGPTPSDTLSSSHLPPRLEPPRTHDPLADVSNDLGHSTQDYKHQEATPAPAPHLGLPLLTDFPQAEQPTSSSHTHSRPKKKSKKHKDKERPPEERPPAPQPDAPTAPALPPDAPGLNGACDNEPTSSSETPDYLLKYPAISSSEQRQSYKNDFNAEYSEYRSLHARIEQITRRFTQLDAQLRQLSQGSDEYETTRGQILQEYRKIKKTNTNYSCEKRRCEYLHRKLAHIKRLIAEYDQRQLQAWP jarid2-eed-1 Interaction between Jarid2, Eed, Ezh2 and Mtf2 identified by coimmunoprecipitation 872543 n/a 872550 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872551 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872552 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872553 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 1C jarid2-eed-2 Interaction between Jarid2, Eed, Ezh2 and Mtf2 identified by coimmunoprecipitation 872543 n/a 872553 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872552 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872550 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872551 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 1C jarid2-eed-3 Interaction between Jarid2 and Eed identified by coimmunoprecipitation 872543 n/a 872551 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872552 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1E mtf2-ezh1-1 Interaction between Mtf2 and Ezh1 identified by coimmunoprecipitation 872543 n/a 872550 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872554 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1D jarid2-ezh1-2 Interaction between Jarid2 and Ezh1 identified by coimmunoprecipitation 872543 n/a 872551 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872554 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1E jarid2-eed-4 Interaction between Jarid2 and Eed identified by coimmunoprecipitation 872543 n/a 872552 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872551 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1E jarid2-ezh2-1 Interaction between Jarid2 and Ezh2 identified by coimmunoprecipitation 872543 n/a 872553 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872551 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1E jarid2-ezh2-2 Interaction between Jarid2 and Ezh2 identified by coimmunoprecipitation 872543 n/a 872551 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872553 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1E jarid2-ezh1-1 Interaction between Jarid2 and Ezh1 identified by coimmunoprecipitation 872543 n/a 872551 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872554 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1E mtf2-ezh2-1 Interaction between Mtf2 and Ezh2 identified by coimmunoprecipitation 872543 n/a 872553 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872550 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1D mtf2-eed-1 Interaction between Mtf2 and Eed identified by coimmunoprecipitation 872543 n/a 872550 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872552 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1D eed-suz12-1 Interactors of Eed, isoform III, flag and biotin tags 872544 n/a 872555 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872554 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872556 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872550 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872551 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872557 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872553 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872558 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872559 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872560 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 1A, Supp. Tables 1 and 2 eed-suz12-3 Interactors of Eed, isoform III, biotin tag 872544 n/a 872551 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872559 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872553 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872554 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872550 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872557 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872560 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872558 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872556 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false association association false false false Fig. 1A, Supp. Tables 1 and 2 eed-suz12-4 Interactors of Eed, isoform IV, flag and biotin tags 872544 n/a 872558 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872561 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872556 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872553 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872550 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872557 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872555 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872551 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872554 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872559 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872562 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872563 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false association association false false false Fig. 1A, Supp. Tables 1 and 2 eezh1-suz12-1 Interactors of Ezh1 872544 n/a 872552 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872550 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872558 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872557 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872554 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872559 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872551 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872555 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false association association false false false Fig. 1A, Supp. Tables 1 and 4 ezh2-suz12-1 Interactors of Ezh2 872544 n/a 872562 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872551 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872553 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872550 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872558 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872559 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872557 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872563 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872556 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872555 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872564 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872552 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false association association false false false Fig. 1A, Supp. Tables 1 and 3 jarid2-suz12-1 Interactors of Jarid2 872544 n/a 872554 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872550 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872558 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872559 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872557 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872563 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872555 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872565 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false release identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872566 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872567 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872568 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872569 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872564 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872552 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872562 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872551 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872553 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false association association false false false Fig. 1A, Supp. Tables 1 and 5 mtf2-suz12-1 Interactors of Mtf2 872544 n/a 872550 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872555 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872554 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872553 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872559 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872552 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872569 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872565 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false release identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false n/a 872564 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false association association false false false Fig. 1A, Supp. Tables 1 and 6 ezh2-jarid2-1 Interaction between Jarid2, Ezh2 and Suz12 identified by coimmunoprecipitation 872545 n/a 872559 unspecified role unspecified role prey prey n/a 872553 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872551 unspecified role unspecified role prey prey association association false false false Fig. 1G, Supp. Fig. 1A ezh2-suz12-2 Interaction between Ezh2 and Suz12 identified by coimmunoprecipitation 872545 n/a 872553 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872559 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1G ezh2-jarid2-4 Interaction between Jarid2 and Ezh2 identified by coimmunoprecipitation 872545 n/a 872551 unspecified role unspecified role prey prey n/a 872553 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false set region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range false physical association physical association false false false Fig. 1G eed-jarid2-4 Interaction between Jarid2, Eed and Suz12 identified by coimmunoprecipitation 872545 n/a 872552 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 872559 unspecified role unspecified role prey prey n/a 872551 unspecified role unspecified role prey prey association association false false false Fig. 1G ezh2-jarid2-8 Interaction between Jarid2, Ezh2 and Suz12 identified by coimmunoprecipitation 872545 n/a 872559 unspecified role unspecified role prey prey spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. n/a 872552 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. n/a 872553 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. n/a 872558 unspecified role unspecified role prey prey spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. n/a 872557 unspecified role unspecified role prey prey spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. association association false false false Fig. 4A ezh2-jarid2-9 Interaction between Jarid2, Ezh2 and Suz12 identified by coimmunoprecipitation 872545 n/a 872558 unspecified role unspecified role prey prey spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. n/a 872557 unspecified role unspecified role prey prey spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. n/a 872559 unspecified role unspecified role prey prey spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. n/a 872553 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. n/a 872552 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. association association false false false Fig. 4A Jarid2 was additionally isolated with this complex, but cthe presence of 2 flag-tagged bait proteins made this impossible to capture. ezh2-jarid2-5 Interaction between Jarid2, Ezh2 and Suz12 identified by coimmunoprecipitation 872546 n/a 872551 unspecified role unspecified role prey prey n/a 872559 unspecified role unspecified role bait bait n/a 872553 unspecified role unspecified role prey prey association association false false false Fig. 1H eed-jarid2-5 Interaction between Jarid2, Eed, Ezh2 and Suz12 identified by coimmunoprecipitation 872546 n/a 872551 unspecified role unspecified role bait bait n/a 872559 unspecified role unspecified role prey prey n/a 872553 unspecified role unspecified role prey prey n/a 872552 unspecified role unspecified role prey prey association association false false false Fig. 1I eed-jarid2-6 Interaction between Jarid2, Eed and Suz12 identified by coimmunoprecipitation 872546 n/a 872552 unspecified role unspecified role prey prey n/a 872551 unspecified role unspecified role bait bait n/a 872559 unspecified role unspecified role prey prey association association false false false Fig. 1I Observed in Ezh2 knock-out cells. Interaction with Suz12 is greatly reduced. ezh2-jarid2-2 Interaction between Jarid2, Ezh2 and Suz12 identified by coimmunoprecipitation 872546 n/a 872551 unspecified role unspecified role bait bait n/a 872553 unspecified role unspecified role prey prey n/a 872559 unspecified role unspecified role prey prey association association false false false Fig. 1I Observed in Eed knockout cells. jarid2-ezh2-3 Interaction between Jarid2 and Ezh2 identified by gel filtration 872547 n/a 872553 unspecified role unspecified role neutral component neutral component n/a 872551 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig. 1F ezh2-jarid2-6 Interaction between Jarid2, Ezh2 and Suz12 identified by coimmunoprecipitation 872548 n/a 872553 unspecified role unspecified role prey prey n/a 872559 unspecified role unspecified role prey prey n/a 872551 unspecified role unspecified role bait bait association association false false false Fig. 1J ezh2-jarid2-7 Interaction between Jarid2, Ezh2 and Suz12 identified by coimmunoprecipitation 872549 n/a 872553 unspecified role unspecified role prey prey n/a 872551 unspecified role unspecified role bait bait n/a 872559 unspecified role unspecified role prey prey association association false false false Fig. 1J