IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ dippold-2009-1 GOLPH3 Bridges Phosphatidylinositol-4- Phosphate and Actomyosin to Stretch and Shape the Golgi to Promote Budding. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay autoradiography autoradiography Dippold HC., Ng MM., Farber-Katz SE., Lee SK., Kerr ML., Peterman MC., Sim R., Wiharto PA., Galbraith KA., Madhavarapu S., Fuchs GJ., Meerloo T., Farquhar MG., Zhou H., Field SJ. Apoptosis - Interactions involving proteins with a function related to apoptosis sjfield@ucsd.edu Cell (0092-8674) 2009 Only protein-protein interactions 4 imex curation dippold-2009-2 GOLPH3 Bridges Phosphatidylinositol-4- Phosphate and Actomyosin to Stretch and Shape the Golgi to Promote Budding. in vitro In vitro liposome binding assay liposome binding assay weight by comassie molecular weight estimation by coomasie staining weight by comassie Dippold HC., Ng MM., Farber-Katz SE., Lee SK., Kerr ML., Peterman MC., Sim R., Wiharto PA., Galbraith KA., Madhavarapu S., Fuchs GJ., Meerloo T., Farquhar MG., Zhou H., Field SJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Small unilamellar lipid vesicles of 55 nmol PE or 55 nmol PE plus 2.5 nmol PtdIns(3)P or PtdIns(4)P were prepared by sonication, vesicle-bound proteins isolated by centrifugation. sjfield@ucsd.edu Cell (0092-8674) 2009 Only protein-protein interactions 4 imex curation dippold-2009-3 GOLPH3 Bridges Phosphatidylinositol-4- Phosphate and Actomyosin to Stretch and Shape the Golgi to Promote Budding. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dippold HC., Ng MM., Farber-Katz SE., Lee SK., Kerr ML., Peterman MC., Sim R., Wiharto PA., Galbraith KA., Madhavarapu S., Fuchs GJ., Meerloo T., Farquhar MG., Zhou H., Field SJ. Apoptosis - Interactions involving proteins with a function related to apoptosis sjfield@ucsd.edu Cell (0092-8674) 2009 Only protein-protein interactions 4 imex curation dippold-2009-4 GOLPH3 Bridges Phosphatidylinositol-4- Phosphate and Actomyosin to Stretch and Shape the Golgi to Promote Budding. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Dippold HC., Ng MM., Farber-Katz SE., Lee SK., Kerr ML., Peterman MC., Sim R., Wiharto PA., Galbraith KA., Madhavarapu S., Fuchs GJ., Meerloo T., Farquhar MG., Zhou H., Field SJ. Apoptosis - Interactions involving proteins with a function related to apoptosis sjfield@ucsd.edu Cell (0092-8674) 2009 Only protein-protein interactions 4 imex curation dippold-2009-5 GOLPH3 Bridges Phosphatidylinositol-4- Phosphate and Actomyosin to Stretch and Shape the Golgi to Promote Budding. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Dippold HC., Ng MM., Farber-Katz SE., Lee SK., Kerr ML., Peterman MC., Sim R., Wiharto PA., Galbraith KA., Madhavarapu S., Fuchs GJ., Meerloo T., Farquhar MG., Zhou H., Field SJ. Apoptosis - Interactions involving proteins with a function related to apoptosis sjfield@ucsd.edu Cell (0092-8674) 2009 Only protein-protein interactions 4 imex curation dippold-2009-6 GOLPH3 Bridges Phosphatidylinositol-4- Phosphate and Actomyosin to Stretch and Shape the Golgi to Promote Budding. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Dippold HC., Ng MM., Farber-Katz SE., Lee SK., Kerr ML., Peterman MC., Sim R., Wiharto PA., Galbraith KA., Madhavarapu S., Fuchs GJ., Meerloo T., Farquhar MG., Zhou H., Field SJ. Apoptosis - Interactions involving proteins with a function related to apoptosis sjfield@ucsd.edu Cell (0092-8674) 2009 Only protein-protein interactions 4 imex curation phosphatidic acids phosphatidic acids small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q9vk31_drome Dmel_CG5439 CG5439 Dmel\CG5439 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPENASSSMPTEAGFRSMRSQLAGSTFGQRREDIFRRLQESAHKISQKFSGKELATERDESVQELCESLEELMSYGLRQSAGTSSFSAASFIQNMQEMVSGNAGGGSNNNDATFWEFCQTHLTPHERQRYMDLKQIWTNVGRGRAFIRATLNEKRLHSHVLTWLSDEEQLHRFYTPWSLLLNDEAAKKLPEIVDSLSDVLFALNVDTTELNAPRRSTPSVAVKEEPIIFTTSPVPVVGRQKRPGIAVERPIECVSSTEDLLGALKPIESVEVQQILSKESIEQELAQPQEEVNLGPFDPIEPELEFLKTPLPDIGAHVGESELYEDRSDTSSQWSKSSSSANCLANSQQQAALEEHVNQLNERCALLETRVAELSLQNRLLIRRLTKQFEETGIDPSSSLCSNFLITIPHVKLAKTQRSGSHYTYEVHITMRQRLEHWTFFRRYSEFYKLHKSLLKTHPVVSAVEFPPKKHFGNMNLVFVEERRQQLQIYLLNLVETLPQVEACKSKAELQKVFPFFRDR pi4p 1-phosphatidyl-1D-myo-inositol 4-phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) vps74_yeast Vacuolar protein sorting-associated protein 74 VPS74 D9481.15 YDR372C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEKETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 9D111E5F894F3646 pi3p 1-phosphatidyl-1D-myo-inositol 3-phosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) golp3_drome Golgi phosphoprotein 3 homolog sauron sau GOLPH3 Protein rotini l(2)s5379 rti CG7085 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNRSDGLVRRSVKPRENGGAEGGLNANTPDDNQDALDNLKDQEDNIDDGDSKETRLTLMEEVLLLGLKDKEGYTSFWNDCISSGLRGCILIELGLRGRVMIEKSGMRRRGLCTRKLILKSDQQTGDVLLDEALKHIKETDPPETVQSWIEYLSGETWNPLKLRYQLKNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLSDNVVKCRLVKKIQDSVLSKWVNDPQRMDKRMLALIFLAHASDVIENAFAPLNDDDYEVAMKRVRELLDLDFEAESAKPNANEILWAVFMAFTK golp3_human Golgi phosphoprotein 3 GOLPH3 GPP34 Coat protein GPP34 Mitochondrial DNA absence factor protein protein human Homo sapiens Human MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK 1-phosphatidyl-1d-myo-inositol 3,5-bisphosphate 1-phosphatidyl-1D-myo-inositol 3,5-bisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q9vsf0_drome WD repeat domain phosphoinositide-interacting protein 2 Atg18A atg18a CG7986 Dmel_CG7986 Atg18 Atg18a atg18.1 ATG18 ATG18.1 Dmel\CG7986 atg18 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MMSLLGRTDVDAGEVFVNFNQNITSLAVATSGGYSLYSLGSVDSTLDKIYHTKSDELFLIERLFESSLVAIVSQRAPRKLKVCHFKKQSEICNYSYANTILAVKLNRERLIVCLEESLYIHNIQDMKVVHTIRDTPCNPQGLCALSSSSEHCYLAYPGSVTAGEVQIFDAINLHAKTMIPAHDTPLAALAFSPSGTEIATASERGTVIRVFSSQDGSRLFELRRGLKRCVSIVSLSFSTCAEYLVSSSNTETVHIFRLDRSATETAEGHGSKQSSDDWMGYSFFRFLSKTVTSYLPTQVTDVFSQGRAFASVTLPEAGVRRMCAIATIQKQLRLLIASQDGYLYVYSIPTVEGAECQLIKRHDLRLEDHYAMDIKGA q9vbd0_drome Tb Dmel\CG5480 Tu TwdlA Dmel_CG5480 CG5480 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MRGFIIFAVLAVARADVGGYNYGAGIGSGGSISGGSLSGGSISGGSISGGSISGGSISGGSISGGSLSSGSLSGGSYSTNYAPVNTEFNKEFFTYSAPEADFEDNKSVSDLAATLKKNLRVVFIRAPENKGLENAALALAKQAAEQQTAIYVLTKQGDLSSLANQLQNLNHVSASKPEVHFVKYRTQQDAINAQRTIQQEYERLGGASTSYNGGVAPVLDFATKVQQQQEQQQQQQQQQVQLIDERRPSSGSVSAELEAPSAGYIPPPAAAPSATYLPVNKVK 1-phosphatidyl-1d-myo-inositol 4,5-bisphosphate 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 1-phosphatidyl-1d-myo-inositol 3,4-bisphosphate 1-phosphatidyl-1D-myo-inositol 3,4-bisphosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) akt1_drome RAC serine/threonine-protein kinase Akt1 CG4006 Akt Protein kinase B protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNYLPFVLQRRSTVVASAPAPGSASRIPESPTTTGSNIINIIYSQSTHPNSSPTSGSAEKFSWQQSWPSRTSAAPTHDSGTMSINTTFDLSSPSVTSGHALTEQTQVVKEGWLMKRGEHIKNWRQRYFVLHSDGRLMGYRSKPADSASTPSDFLLNNFTVRGCQIMTVDRPKPFTFIIRGLQWTTVIERTFAVESELERQQWTEAIRNVSSRLIDVGEVAMTPSEQTDMTDVDMATIAEDELSEQFSVQGTTCNSSGVKKVTLENFEFLKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTLTESRVLKSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVELTPPDPTGPLGSIAEEPLFPQFSYQGDMASTLGTSSHISTSTSLASMQ 1-phosphatidyl-1d-myo-inositol 3,4,5-trisphosphate 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q9y128_drome Ceramide transfer protein Collagen type IV alpha-3-binding protein cert BcDNA.GH07688 BcDNA:GH07688 CERT Dcert Dmel\CG7207 dcert Dmel_CG7207 CG7207 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDTNAGESLGASPPSSNEAAAGSQSQSDASEEEEYLDNSIELRGYLSKWTNYIYGWQPRYIVLKDGTLSYYKSESESDFGCRGAISLTKATIKAHESDELRFDVVVNNLNNWCLRAETSEDRMHWVDVLQLYKADSGSTDTTSLRRHGSTMSLQSNTISLTSGGSLKKTQRNLREKVGELETFKDILFGQIETLQRYFDACSEVNKNNAQPLDLGDGLKSIDFKGESITFRATTSGVLTTLQHCLEIIAESDESWKRKLEREIDKRRRSEDQSKKLKDEVEKMKRLSYPGPDFEEGPHSTLPEDEFFDAVETGLDKIEEDMQLRFKLKLQSQISQTLVNVPHEAVAEGEEAREEFGTGAEATSHALWPEIDRVCKEQLHYAREGVGQDGNGWQIFADEGEIKMYKREEEVNGLVMDPLKAYHTVQGVTAREMCHYFFMPEFRNDWETTLEDCTILEKISADTLLFLQTHKRIWPASQRDAQFWSHMRKITDNLEPGARDMWVVCNNSTEYAKQESKNGKCVRIFLTVILACQTHLPEGYVKGQPLNRNDLTCKITYCSVVNPGGWAPASALRAVYKREYPKFLKRFTGYVIDQCKDKPIMF q7k9h6_drome Zinc finger FYVE domain-containing protein Sara Sara-RA Dmel\CG15667 SARA dSARA sara CG15667 Dmel_CG15667 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDLVDIDQVLDNLELSIAADEQLSRNAAAAAAAGANPGRFLGDGASASISGVGAGAGVSGAAGVTPTPASGKSFVGVSQVFNSLDDYRENVKSLQVDAQLPSYDWQTEAEHEDDIHKFSEQASKNNGQTIVSSSESLTTSSCSTFSSGPSPVSNGSHSEELATPPEDEKTSEVQVEPKEQDQQPEQVKHEDQHQDQAVPPPTQSKQTVEELAVGLSSISITASGTESQSLLPEEVTASSVLGQVLEELSEESSPSREPETEMTNGIDVPLANLPASVAEVPVPKEMEQPVQTEEEDVELPQEQHPRRSQPLTFCSTMDEISDTELDSMLQEMDADDNQADDQQMPDDEKSCSASPVTEEESVRILSDEQETTSNDQMNVDNFSQASTVEFADLKQPESTPVTAMGEDVASSFSSTESDSLSGRKLDGEVEVDREHEDASLATDALETQEQRPQRPQTLNLNGCQAESSTPSQDENPEIQQETLQPTEVREGAAGVGVIPGEDDEESPIYEAVGYSDPHANLGKVPPIWVPDNMAGQCMQCQQKFTMIKRRHHCRACGKVLCSVCCSQRFRLEFATEPESRVCVQCYMILSERQANGLNSESAPGSALPPTPIRSPNPNNPMEYCSTIPPHRQVANSPGAPPPSVIVPVGVLKKTDGSSSNSSSSDGQKGQRKRKSVMFSDGIAPGSELASTMEQQWGESKHSRRGLSRSGSGAGQKPPTPATEEPPRSIDTSSTLGLVAQLFRGSIPPSAAAATLSATETSAGRSSSQSQAQTSPRRKAESSRNRKLPPNGDAQGCYLPPEENGLPPICISSKEGGEVDYKVVRNDGSLLDRLQNETLKFIIKNNFFVLVKIVNMSCCMNRWVLNFTTSGLHHMGSDELIILLEIKQPKQEEYVKGEVAIPKDLFQHLYEIYVEAEHARSGTHELAFTSPRNANFLGSREHGGFIFIRPTYQCLQGVIVPDNPYLVGVLIHRHEVPWAKVLPLRLILRLGAQYRYYPCPLISVRGRESVYGEIAQTIINFLVDFRNYSYSLPAIRGLYIHMEDRQTTVIIPKYRQQDVIKAINNASDHILAFAGNFSKVADGHLVCMQNINDDRSEMYSYSTQAINIQGQPRKITGASFFVLNEALKSSSGLSGKCSIVEDGLMVQIMPAKMEEVRQALRNQNDIDIVCGPIDATDDQSEIVSIKWVDNNRDINVGVKSPIDDQPMDGISNMRVLKWASFNYSNTNYAIRLSDIYIIKCEDWYATNGGNCEEITRIAEQLARSASMALLPLLDLLAAAGINKLGLRATLDQDNVGYEAGARGSKLPPLYMNALDNHLIATLHGESSGIQEPIILELIFYILNA my18a_human Unconventional myosin-XVIIIa Myosin containing a PDZ domain Molecule associated with JAK3 N-terminus MYO18A KIAA0216 MYSPDZ CD245 Surfactant protein receptor SP-R210 protein protein human Homo sapiens Human MFNLMKKDKDKDGGRKEKKEKKEKKERMSAAELRSLEEMSLRRGFFNLNRSSKRESKTRLEISNPIPIKVASGSDLHLTDIDSDSNRGSVILDSGHLSTASSSDDLKGEEGSFRGSVLQRAAKFGSLAKQNSQMIVKRFSFSQRSRDESASETSTPSEHSAAPSPQVEVRTLEGQLVQHPGPGIPRPGHRSRAPELVTKKFPVDLRLPPVVPLPPPTLRELELQRRPTGDFGFSLRRTTMLDRGPEGQACRRVVHFAEPGAGTKDLALGLVPGDRLVEINGHNVESKSRDEIVEMIRQSGDSVRLKVQPIPELSELSRSWLRSGEGPRREPSDAKTEEQIAAEEAWNETEKVWLVHRDGFSLASQLKSEELNLPEGKVRVKLDHDGAILDVDEDDVEKANAPSCDRLEDLASLVYLNESSVLHTLRQRYGASLLHTYAGPSLLVLGPRGAPAVYSEKVMHMFKGCRREDMAPHIYAVAQTAYRAMLMSRQDQSIILLGSSGSGKTTSCQHLVQYLATIAGISGNKVFSVEKWQALYTLLEAFGNSPTIINGNATRFSQILSLDFDQAGQVASASIQTMLLEKLRVARRPASEATFNVFYYLLACGDGTLRTELHLNHLAENNVFGIVPLAKPEEKQKAAQQFSKLQAAMKVLGISPDEQKACWFILAAIYHLGAAGATKEAAEAGRKQFARHEWAQKAAYLLGCSLEELSSAIFKHQHKGGTLQRSTSFRQGPEESGLGDGTGPKLSALECLEGMAAGLYSELFTLLVSLVNRALKSSQHSLCSMMIVDTPGFQNPEQGGSARGASFEELCHNYTQDRLQRLFHERTFVQELERYKEENIELAFDDLEPPTDDSVAAVDQASHQSLVRSLARTDEARGLLWLLEEEALVPGASEDTLLERLFSYYGPQEGDKKGQSPLLHSSKPHHFLLGHSHGTNWVEYNVTGWLNYTKQNPATQNAPRLLQDSQKKIISNLFLGRAGSATVLSGSIAGLEGGSQLALRRATSMRKTFTTGMAAVKKKSLCIQMKLQVDALIDTIKKSKLHFVHCFLPVAEGWAGEPRSASSRRVSSSSELDLPSGDHCEAGLLQLDVPLLRTQLRGSRLLDAMRMYRQGYPDHMVFSEFRRRFDVLAPHLTKKHGRNYIVVDERRAVEELLECLDLEKSSCCMGLSRVFFRAGTLARLEEQRDEQTSRNLTLFQAACRGYLARQHFKKRKIQDLAIRCVQKNIKKNKGVKDWPWWKLFTTVRPLIEVQLSEEQIRNKDEEIQQLRSKLEKAEKERNELRLNSDRLESRISELTSELTDERNTGESASQLLDAETAERLRAEKEMKELQTQYDALKKQMEVMEMEVMEARLIRAAEINGEVDDDDAGGEWRLKYERAVREVDFTKKRLQQEFEDKLEVEQQNKRQLERRLGDLQADSEESQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDSELSQAHEEAQREKLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAELQDISSQESKDEASLAKVKKQLRDLEAKVKDQEEELDEQAGTIQMLEQAKLRLEMEMERMRQTHSKEMESRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEGKLATLSDQVNRRDFESEKRLRKDLKRTKALLADAQLMLDHLKNSAPSKREIAQLKNQLEESEFTCAAAVKARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKAAVAQASRDLAQINDLQAQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKIRELETRLEFERTQVKRLESLASRLKENMEKLTEERDQRIAAENREKEQNKRLQRQLRDTKEEMGELARKEAEASRKKHELEMDLESLEAANQSLQADLKLAFKRIGDLQAAIEDEMESDENEDLINSLQDMVTKYQKRKNKLEGDSDVDSELEDRVDGVKSWLSKNKGPSKAASDDGSLKSSSPTSYWKSLAPDRSDDEHDPLDNTSRPRYSHSYLSDSDTEAKLTETNA pa-snx29-1 Binding of SNX29 to phosphatidic acid 860177 n/a 860183 unspecified role unspecified role bait bait n/a 860184 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 1A pi4p-vps74-1 Binding of VPS74 to PI4P 860177 n/a 860185 unspecified role unspecified role bait bait n/a 860186 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 1A pi3p-snx29-1 Binding of SNX29 to PtdIns(3)P 860177 n/a 860184 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 860187 unspecified role unspecified role bait bait direct interaction direct interaction false false false Fig. 1 pi4p-golph3-1 Binding of GOLPH3 to PtdIns(4)P 860177 n/a 860188 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 860185 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figs. 1A, 2A Sequence of Q9VQ93 is one amino acid longer than the length of GOLPH3 given in the text. pi4p-golph3-2 Binding of GOLPH3 to PtdIns(4)P 860177 n/a 860189 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 860185 unspecified role unspecified role bait bait direct interaction direct interaction false false false Fig. 1A pi35p-atg18-1 Binding of ATG18 to PtdIns(3,5)P 860177 n/a 860190 unspecified role unspecified role bait bait n/a 860191 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 1A pi45p-tubby-1 Binding of TUBBY to PtdIns(4,5)P 860177 n/a 860192 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 860193 unspecified role unspecified role bait bait direct interaction direct interaction false false false Fig. 1A pi34p-akt1-1 Binding of AKT1 to PtdIns(3,4)P 860177 n/a 860194 unspecified role unspecified role bait bait n/a 860195 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 1A pi345p-akt1-1 Binding of AKT1 to PtdIns(3,4,5)P 860177 n/a 860195 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 860196 unspecified role unspecified role bait bait direct interaction direct interaction false false false Fig. 1 pi4p-cert-1 Binding of CERT to PtdIns(4)P 860177 n/a 860185 unspecified role unspecified role bait bait n/a 860197 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false Fig. 1 pi3p-sara-1 Binding of SARA to PtdIns(3)P 860177 n/a 860187 unspecified role unspecified role bait bait n/a 860198 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 1 pi3p-atg18-1 Binding of ATG18 to PtdIns(3)P 860177 n/a 860191 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 860187 unspecified role unspecified role bait bait direct interaction direct interaction false false false Fig. 1A pi4p-golph3-4 Binding of GOLPH3 to PtdIns(4)P 860177 n/a 860188 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 860185 unspecified role unspecified role bait bait direct interaction direct interaction false false false Supp. Fig. 1 pi4p-golph3-5 Binding of GOLPH3 to PtdIns(4)P 860177 n/a 860185 unspecified role unspecified role bait bait n/a 860189 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Supp. Fig. 1 pi4p-golph3-3 Binding of GOLPH3 to PtdIns(4)P 860178 n/a 860189 unspecified role unspecified role prey prey Q9H4A6:p.[Arg171Ala;Arg174Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9H4A6:p.Arg90Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro n/a 860185 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figs. 2D golph3-myo18a Interaction between GOLPH3 and MYO18A determined by coimmunoprecipitation 860179 n/a 860189 unspecified role unspecified role bait bait n/a 860199 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4C golph3-myo18a-1 Interaction between GOLPH3 and MYO18A determined by pulldown 860180 n/a 860199 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region SUMO tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 860189 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 4E golph3-myo18a-2 Colocalisation of GOLPH3 and MYO18A 860181 n/a 860189 unspecified role unspecified role neutral component neutral component n/a 860199 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 4F The Golgi protein GOLGA4 was searately shown to localise in the same region. Knockdown of GOLPH3 causes loss of MYO18A from Golgi golph3-myo18a-3 Interaction between GOLPH3 and MYO18A determined by coimmunoprecipitation 860182 n/a 860189 unspecified role unspecified role bait bait n/a 860199 unspecified role unspecified role prey prey physical association physical association false false false Supp. Fig. 12