IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wessel-2009-1 LC-MS/MS as an alternative for SDS-PAGE in blue native analysis of protein complexes human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bn-page blue native page bn-page sequence tag sequence tag identification sequence tag Hans J. C. T. Wessels,Rutger O. Vogel,Lambert van den Heuvel,Jan A. Smeitink,Richard J. Rodenburg,Leo G. Nijtmans,Murtada H. Farhoud Apoptosis - Interactions involving proteins with a function related to apoptosis The authors used BN 4-12% gradient gels. Processed quantitative information (emPAI or XIC) is then used to generate abundancy traces for each protein, which can be used to identify protein complexes. Next, Protein Correlation Profiling is used to identify putative protein interactions (candidates) by correlation with protein traces of interest (template). The UniProtKB IDs of the interactors were deduced from the GI number in the supplementary table 1. murtada.farhoud@gmail.com proteomics 2009 Only protein-protein interactions imex curation Hans J. C. T. Wessels, Rutger O. Vogel, Lambert van den Heuvel, Jan A. Smeitink, Richard J. Rodenburg, Leo G. Nijtmans, Murtada H. Farhoud, Wessels HJ., Vogel RO., van den Heuvel L., Smeitink JA., Rodenburg RJ., Nijtmans LG., Farhoud MH. Proteomics wessel-2009-2 LC-MS/MS as an alternative for SDS-PAGE in blue native analysis of protein complexes human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bn-page blue native page bn-page sequence tag sequence tag identification sequence tag Hans J. C. T. Wessels,Rutger O. Vogel,Lambert van den Heuvel,Jan A. Smeitink,Richard J. Rodenburg,Leo G. Nijtmans,Murtada H. Farhoud Apoptosis - Interactions involving proteins with a function related to apoptosis The authors used BN 4-12% gradient gels. Processed quantitative information (emPAI or XIC) is then used to generate abundancy traces for each protein, which can be used to identify protein complexes. Next, Protein Correlation Profiling is used to identify putative protein interactions (candidates) by correlation with protein traces of interest (template). The UniProtKB IDs of the interactors were deduced from the GI number in the supplementary table 1. murtada.farhoud@gmail.com proteomics 2009 Only protein-protein interactions imex curation Hans J. C. T. Wessels, Rutger O. Vogel, Lambert van den Heuvel, Jan A. Smeitink, Richard J. Rodenburg, Leo G. Nijtmans, Murtada H. Farhoud, Wessels HJ., Vogel RO., van den Heuvel L., Smeitink JA., Rodenburg RJ., Nijtmans LG., Farhoud MH. Proteomics wessel-2009-3 LC-MS/MS as an alternative for SDS-PAGE in blue native analysis of protein complexes human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot Hans J. C. T. Wessels,Rutger O. Vogel,Lambert van den Heuvel,Jan A. Smeitink,Richard J. Rodenburg,Leo G. Nijtmans,Murtada H. Farhoud Apoptosis - Interactions involving proteins with a function related to apoptosis The authors used BN 4-12% gradient gels. Processed quantitative information (emPAI or XIC) is then used to generate abundancy traces for each protein, which can be used to identify protein complexes. Next, Protein Correlation Profiling is used to identify putative protein interactions (candidates) by correlation with protein traces of interest (template). The UniProtKB IDs of the interactors were deduced from the GI number in the supplementary table 1. murtada.farhoud@gmail.com proteomics 2009 Only protein-protein interactions imex curation Hans J. C. T. Wessels, Rutger O. Vogel, Lambert van den Heuvel, Jan A. Smeitink, Richard J. Rodenburg, Leo G. Nijtmans, Murtada H. Farhoud, Wessels HJ., Vogel RO., van den Heuvel L., Smeitink JA., Rodenburg RJ., Nijtmans LG., Farhoud MH. Proteomics wessel-2009-4 LC-MS/MS as an alternative for SDS-PAGE in blue native analysis of protein complexes human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot Hans J. C. T. Wessels,Rutger O. Vogel,Lambert van den Heuvel,Jan A. Smeitink,Richard J. Rodenburg,Leo G. Nijtmans,Murtada H. Farhoud Apoptosis - Interactions involving proteins with a function related to apoptosis The authors used BN 4-12% gradient gels. Processed quantitative information (emPAI or XIC) is then used to generate abundancy traces for each protein, which can be used to identify protein complexes. Next, Protein Correlation Profiling is used to identify putative protein interactions (candidates) by correlation with protein traces of interest (template). The UniProtKB IDs of the interactors were deduced from the GI number in the supplementary table 1. murtada.farhoud@gmail.com proteomics 2009 Only protein-protein interactions imex curation Hans J. C. T. Wessels, Rutger O. Vogel, Lambert van den Heuvel, Jan A. Smeitink, Richard J. Rodenburg, Leo G. Nijtmans, Murtada H. Farhoud, Wessels HJ., Vogel RO., van den Heuvel L., Smeitink JA., Rodenburg RJ., Nijtmans LG., Farhoud MH. Proteomics ndua4_human Cytochrome c oxidase subunit NDUFA4 NADH-ubiquinone oxidoreductase MLRQ subunit Complex I-MLRQ NDUFA4 protein protein human Homo sapiens Human MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF ndub5_human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial NDUFB5 NADH-ubiquinone oxidoreductase SGDH subunit Complex I-SGDH protein protein human Homo sapiens Human MAAMSLLRRVSVTAVAALSGRPLGTRLGFGGFLTRGFPKAAAPVRHSGDHGKRLFVIRPSRFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN nu1m_human NADH-ubiquinone oxidoreductase chain 1 MT-ND1 MTND1 NADH1 ND1 NADH dehydrogenase subunit 1 protein protein human Homo sapiens Human MPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEPLKPATSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGLLFILATSSLAVYSILWSGWASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMSGSFNLSTLITTQEHLWLLLPSWPLAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTTIFLGTTYDALSPELYTTYFVTKTLLLTSLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLALLMWYVSMPITISSIPPQT nduba_human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 NDUFB10 NADH-ubiquinone oxidoreductase PDSW subunit Complex I-PDSW protein protein human Homo sapiens Human MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS ndub7_human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 NDUFB7 NADH-ubiquinone oxidoreductase B18 subunit Complex I-B18 Cell adhesion protein SQM1 protein protein human Homo sapiens Human MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL nduaa_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial NDUFA10 NADH-ubiquinone oxidoreductase 42 kDa subunit Complex I-42kD protein protein human Homo sapiens Human MALRLLKLAATSASARVVAAGAQRVRGIHSSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLTTGQGVVLERSIFSDFVFLEAMYNQGFIRKQCVDHYNEVKSVTICDYLPPHLVIYIDVPVPEVQRRIQKKGDPHEMKITSAYLQDIENAYKKTFLPEMSEKCEVLQYSAREAQDSKKVVEDIEYLKFDKGPWLKQDNRTLYHLRLLVQDKFEVLNYTSIPIFLPEVTIGAHQTDRVLHQFRELPGRKYSPGYNTEVGDKWIWLK nu4m_human NADH-ubiquinone oxidoreductase chain 4 MT-ND4 MTND4 NADH4 ND4 NADH dehydrogenase subunit 4 protein protein human Homo sapiens Human MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQINNNLFSCSPTFSSDPLTTPLLMLTTWLLPLTIMASQRHLSSEPLSRKKLYLSMLISLQISLIMTFTATELIMFYIFFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLTLTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSICLRQTDLKSLIAYSSISHMALVVTAILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWLLASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLVTALYSLYMFTTTQWGSLTHHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS nduv2_human NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial NADH-ubiquinone oxidoreductase 24 kDa subunit NDUFV2 protein protein human Homo sapiens Human MFFSAALRARAAGLTAHWGRHVRNLHKTVMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL ndub3_human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 NADH-ubiquinone oxidoreductase B12 subunit Complex I-B12 NDUFB3 protein protein human Homo sapiens Human MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH ndubb_human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial NDUFB11 UNQ111/PRO1064 NADH-ubiquinone oxidoreductase ESSS subunit Complex I-ESSS Neuronal protein 17.3 protein protein human Homo sapiens Human MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE nduc2_human NADH dehydrogenase [ubiquinone] 1 subunit C2 NDUFC2 HLC1 NADH-ubiquinone oxidoreductase subunit B14.5b Complex I-B14.5b Human lung cancer oncogene 1 protein protein protein human Homo sapiens Human MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR ndus8_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial NDUFS8 NADH-ubiquinone oxidoreductase 23 kDa subunit Complex I-23kD TYKY subunit protein protein human Homo sapiens Human MRCLTTPMLLRALAQAARAGPPGGRSLHSSAVAATYKYVNMQDPEMDMKSVTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR ndua8_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 NDUFA8 NADH-ubiquinone oxidoreductase 19 kDa subunit Complex I-19kD Complex I-PGIV protein protein human Homo sapiens Human MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK ndub9_human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 LYRM3 NADH-ubiquinone oxidoreductase B22 subunit Complex I-B22 LYR motif-containing protein 3 NDUFB9 UQOR22 protein protein human Homo sapiens Human MAFLASGPYLTHQQKVLRLYKRALRHLESWCVQRDKYRYFACLMRARFEEHKNEKDMAKATQLLKEAEEEFWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQEETPPGGPLTEALPPARKEGDLPPLWWYIVTRPRERPM ndus6_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial NADH-ubiquinone oxidoreductase 13 kDa-A subunit Complex I-13kD-A NDUFS6 protein protein human Homo sapiens Human MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH ndus4_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial NDUFS4 NADH-ubiquinone oxidoreductase 18 kDa subunit Complex I-18 kDa Complex I-AQDQ protein protein human Homo sapiens Human MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK nduv1_human NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial NADH-ubiquinone oxidoreductase 51 kDa subunit Complex I-51kD NADH dehydrogenase flavoprotein 1 NDUFV1 UQOR1 protein protein human Homo sapiens Human MLATRRLLGWSLPARVSVRFSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRGDWYKTKEILLKGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS ndus7_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial NADH-ubiquinone oxidoreductase 20 kDa subunit Complex I-20kD PSST subunit NDUFS7 protein protein human Homo sapiens Human MAVLSAPGLRGFRILGLRSSVGPAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR nduad_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 NDUFA13 CGI-39 CDA016 NADH-ubiquinone oxidoreductase B16.6 subunit Complex I-B16.6 Gene associated with retinoic and interferon-induced mortality 19 protein Cell death regulatory protein GRIM-19 GRIM19 protein protein human Homo sapiens Human MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT nduab_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 NDUFA11 NADH-ubiquinone oxidoreductase subunit B14.7 Complex I-B14.7 protein protein human Homo sapiens Human MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIAASLVKMGRLEGWEVFAKPKV ndus1_human NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial NDUFS1 Complex I-75kD protein protein human Homo sapiens Human MLRIPVRKALVGLSKSPKGCVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQSFQGKDVAAIAGGLVDAEALVALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSALQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQAVEEPSIC ndus2_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial NDUFS2 NADH-ubiquinone oxidoreductase 49 kDa subunit Complex I-49kD protein protein human Homo sapiens Human MAALRALCGFRGVAAQVLRPGAGVRLPIQPSRGVRQWQPDVEWAQQFGGAVMYPSKETAHWKPPPWNDVDPPKDTIVKNITLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRLLNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLMDDIYQFSKNFSLRLDELEELLTNNRIWRNRTIDIGVVTAEEALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR ndua7_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 NADH-ubiquinone oxidoreductase subunit B14.5a Complex I-B14.5a NDUFA7 protein protein human Homo sapiens Human MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGRRESVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL nduac_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 NDUFA12 DAP13 NADH-ubiquinone oxidoreductase subunit B17.2 Complex I-B17.2 13 kDa differentiation-associated protein protein protein human Homo sapiens Human MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK ndua9_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial NADH-ubiquinone oxidoreductase 39 kDa subunit Complex I-39kD NDUFA9 NDUFS2L protein protein human Homo sapiens Human MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPVYVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLLFHLVKYIFAVAHRLFLPFPLPLFAYRWVARVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI nduv3_human NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial Complex I-9kD Renal carcinoma antigen NY-REN-4 NADH-ubiquinone oxidoreductase 9 kDa subunit NDUFV3 protein protein human Homo sapiens Human MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH ndua6_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 LYRM6 NADH-ubiquinone oxidoreductase B14 subunit Complex I-B14 LYR motif-containing protein 6 NDUFA6 NADHB14 protein protein human Homo sapiens Human MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP ndus5_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 NDUFS5 NADH-ubiquinone oxidoreductase 15 kDa subunit Complex I-15 kDa protein protein human Homo sapiens Human MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP ndub8_human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial NADH-ubiquinone oxidoreductase ASHI subunit Complex I-ASHI NDUFB8 protein protein human Homo sapiens Human MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI ndua2_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 NDUFA2 NADH-ubiquinone oxidoreductase B8 subunit Complex I-B8 protein protein human Homo sapiens Human MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA ndus3_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial NDUFS3 NADH-ubiquinone oxidoreductase 30 kDa subunit Complex I-30kD protein protein human Homo sapiens Human MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK C058D62779BEF17B ndua5_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 Complex I subunit B13 NADH-ubiquinone oxidoreductase 13 kDa-B subunit Complex I-13kD-B NDUFA5 protein protein human Homo sapiens Human MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI sdhb_human Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial SDHB SDH SDH1 Iron-sulfur subunit of complex II protein protein human Homo sapiens Human MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV sdha_human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial SDHA SDH2 SDHF Flavoprotein subunit of complex II protein protein human Homo sapiens Human MSGVRGLSRLLSARRLALAKAWPTVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDKVPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKISKLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRIDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVGTGKVTLEYRPVIDKTLNEADCATVPPAIRSY qcr9_human Cytochrome b-c1 complex subunit 9 UQCR10 HSPC119 UCRC Ubiquinol-cytochrome c reductase complex 7.2 kDa protein Cytochrome c1 non-heme 7 kDa protein Complex III subunit X Complex III subunit 9 protein protein human Homo sapiens Human MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK qcr8_human Cytochrome b-c1 complex subunit 8 Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C Ubiquinol-cytochrome c reductase complex 9.5 kDa protein Complex III subunit VIII Complex III subunit 8 UQCRQ protein protein human Homo sapiens Human MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK qcr7_human Cytochrome b-c1 complex subunit 7 Ubiquinol-cytochrome c reductase complex 14 kDa protein Complex III subunit 7 Complex III subunit VII QP-C UQCRB UQBP protein protein human Homo sapiens Human MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK qcr1_human Cytochrome b-c1 complex subunit 1, mitochondrial Ubiquinol-cytochrome-c reductase complex core protein 1 Complex III subunit 1 UQCRC1 Core protein I protein protein human Homo sapiens Human MAASVVCRAATAGAQVLLRARRSPALLRTPALRSTATFAQALQFVPETQVSLLDNGLRVASEQSSQPTCTVGVWIDVGSRFETEKNNGAGYFLEHLAFKGTKNRPGSALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLGDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGGIPWTYAEDAVPTLTPCRFTGSEIRHRDDALPFAHVAIAVEGPGWASPDNVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAETGLLGAHFVCDRMKIDDMMFVLQGQWMRLCTSATESEVARGKNILRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDASVVREICSKYIYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF ucri_human Cytochrome b-c1 complex subunit Rieske, mitochondrial Ubiquinol-cytochrome c reductase iron-sulfur subunit Rieske iron-sulfur protein Complex III subunit 5 Rieske protein UQCRFS1 UQCRFS1 Cytochrome b-c1 complex subunit 5 protein protein human Homo sapiens Human MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAVRRPLVASVGLNVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG qcr2_human Cytochrome b-c1 complex subunit 2, mitochondrial Ubiquinol-cytochrome-c reductase complex core protein 2 Core protein II Complex III subunit 2 UQCRC2 protein protein human Homo sapiens Human MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL cox2_human Cytochrome c oxidase subunit 2 MT-CO2 COII COXII MTCO2 Cytochrome c oxidase polypeptide II COX2 protein protein human Homo sapiens Human MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL cox5b_human Cytochrome c oxidase subunit 5B, mitochondrial Cytochrome c oxidase polypeptide Vb COX5B protein protein human Homo sapiens Human MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH cx7a2_human Cytochrome c oxidase subunit 7A2, mitochondrial COX7AL Cytochrome c oxidase subunit VIIa-liver/heart COX7A2 protein protein human Homo sapiens Human MLRNLLALRQIGQRTISTASRRHFKNKVPEKQKLFQEDDEIPLYLKGGVADALLYRATMILTVGGTAYAIYELAVASFPKKQE cox6c_human Cytochrome c oxidase subunit 6C COX6C Cytochrome c oxidase polypeptide VIc protein protein human Homo sapiens Human MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK cox41_human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial COX4I1 COX4 Cytochrome c oxidase subunit IV isoform 1 Cytochrome c oxidase polypeptide IV protein protein human Homo sapiens Human MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK cox5a_human Cytochrome c oxidase subunit 5A, mitochondrial Cytochrome c oxidase polypeptide Va COX5A protein protein human Homo sapiens Human MLGAALRRCAVAATTRADPRGLLHSARTPGPAVAIQSVRCYSHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV cx6b1_human Cytochrome c oxidase subunit 6B1 COX6B1 COX6B Cytochrome c oxidase subunit VIb isoform 1 protein protein human Homo sapiens Human MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI cox7c_human Cytochrome c oxidase subunit 7C, mitochondrial Cytochrome c oxidase polypeptide VIIc COX7C protein protein human Homo sapiens Human MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT atpa_human ATP synthase subunit alpha, mitochondrial ATP5F1A ATP synthase F1 subunit alpha ATP5A ATP5A1 ATP5AL2 ATPM protein protein human Homo sapiens Human MLSVRVAAAVVRALPRRAGLVSRNALGSSFIAARNFHASNTHLQKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVVSQHQALLGTIRADGKISEQSDAKLKEIVTNFLAGFEA atpg_human ATP synthase subunit gamma, mitochondrial ATP5F1C ATP synthase F1 subunit gamma ATP5C ATP5C1 ATP5CL1 F-ATPase gamma subunit protein protein human Homo sapiens Human MFSRAGVAGLSAWTLQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARIYGLGSLALYEKADIKGPEDKKKHLLIGVSSDRGLCGAIHSSIAKQMKSEVATLTAAGKEVMLVGIGDKIRGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVASADSMSIYDDIDADVLQNYQEYNLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD atp5j_human ATP synthase-coupling factor 6, mitochondrial ATP5PF ATP synthase peripheral stalk subunit F6 ATP5A ATP5J ATPM protein protein human Homo sapiens Human MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA atpk_human ATP synthase subunit f, mitochondrial ATP5MF ATP synthase membrane subunit f ATP5J2 ATP5JL protein protein human Homo sapiens Human MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH atp5h_human ATP synthase subunit d, mitochondrial ATP5PD ATP synthase peripheral stalk subunit d ATP5H My032 protein protein human Homo sapiens Human MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL atpd_human ATP synthase subunit delta, mitochondrial ATP5F1D ATP synthase F1 subunit delta ATP5D F-ATPase delta subunit protein protein human Homo sapiens Human MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE atp5s_human ATP synthase subunit s, mitochondrial DMAC2L ATP synthase-coupling factor B ATP5S ATPW Distal membrane arm assembly complex 2-like protein Mitochondrial ATP synthase regulatory component factor B protein protein human Homo sapiens Human MCCAVSEQRLTCADQMMPFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRCGAMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLEHVEKIRLCKCHYIEDDCLLRLSQLENLQKTILEMEIISCGNITDKGIIALRHLRNLKYLLLSDLPGVREKENLVQAFKTALPSLELKLQLK atpb_human ATP synthase subunit beta, mitochondrial ATP5F1B ATP synthase F1 subunit beta ATP5B ATPMB ATPSB protein protein human Homo sapiens Human MLGFVGRVAAAPASGALRRLTPSASLPPAQLLLRAAPTAVHPVRDYAAQTSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS atp5l_human ATP synthase subunit g, mitochondrial ATP5MG ATP synthase membrane subunit g ATP5L protein protein human Homo sapiens Human MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV at5f1_human ATP synthase F(0) complex subunit B1, mitochondrial ATP5PB ATP synthase peripheral stalk-membrane subunit b ATP synthase proton-transporting mitochondrial F(0) complex subunit B1 ATP synthase subunit b ATP5F1 protein protein human Homo sapiens Human MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM atp5i_human ATP synthase subunit e, mitochondrial ATP5ME ATP5I ATP synthase membrane subunit e ATP5K protein protein human Homo sapiens Human MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK nduf3_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3 NDUFAF3 C3orf60 protein protein human Homo sapiens Human MATALALRSLYRARPSLRCPPVELPWAPRRGHRLSPADDELYQRTRISLLQREAAQAMYIDSYNSRGFMINGNRVLGPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ nduf4_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4 NDUFAF4 C6orf66 HRPAP20 Hormone-regulated proliferation-associated protein of 20 kDa HSPC125 My013 protein protein human Homo sapiens Human MGALVIRGIRNFNLENRAEREISKMKPSVAPRHPSTNSLLREQISLYPEVKGEIARKDEKLLSFLKDVYVDSKDPVSSLQVKAAETCQEPKEFRLPKDHHFDMINIKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQEYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK ndufa2-ndufa4-1 physical association of several NADH:ubiquinone oxidoreductase I subunits with c3orf60, c3orf66, dhx30, vlcad and cds2 885006 ndua4_human 885010 unspecified role unspecified role neutral component neutral component ndub5_human 885011 unspecified role unspecified role neutral component neutral component nu1m_human 885012 unspecified role unspecified role neutral component neutral component nduba_human 885013 unspecified role unspecified role neutral component neutral component ndub7_human 885014 unspecified role unspecified role neutral component neutral component nduaa_human 885015 unspecified role unspecified role neutral component neutral component nu4m_human 885016 unspecified role unspecified role neutral component neutral component nduv2_human 885017 unspecified role unspecified role neutral component neutral component ndub3_human 885018 unspecified role unspecified role neutral component neutral component ndubb_human 885019 unspecified role unspecified role neutral component neutral component nduc2_human 885020 unspecified role unspecified role neutral component neutral component ndus8_human 885021 unspecified role unspecified role neutral component neutral component ndua8_human 885022 unspecified role unspecified role neutral component neutral component ndub9_human 885023 unspecified role unspecified role neutral component neutral component ndus6_human 885024 unspecified role unspecified role neutral component neutral component ndus4_human 885025 unspecified role unspecified role neutral component neutral component nduv1_human 885026 unspecified role unspecified role neutral component neutral component ndus7_human 885027 unspecified role unspecified role neutral component neutral component nduad_human 885028 unspecified role unspecified role neutral component neutral component nduab_human 885029 unspecified role unspecified role neutral component neutral component ndus1_human 885030 unspecified role unspecified role neutral component neutral component ndus2_human 885031 unspecified role unspecified role neutral component neutral component ndua7_human 885032 unspecified role unspecified role neutral component neutral component nduac_human 885033 unspecified role unspecified role neutral component neutral component ndua9_human 885034 unspecified role unspecified role neutral component neutral component nduv3_human 885035 unspecified role unspecified role neutral component neutral component ndua6_human 885036 unspecified role unspecified role neutral component neutral component ndus5_human 885037 unspecified role unspecified role neutral component neutral component ndub8_human 885038 unspecified role unspecified role neutral component neutral component ndua2_human 885039 unspecified role unspecified role neutral component neutral component ndus3_human 885040 unspecified role unspecified role neutral component neutral component ndua5_human 885041 unspecified role unspecified role neutral component neutral component physical association physical association false false false Supplementary table 1, Fig. 2 A and B, Table 1 and supporting information Fig. 3 The authors identified 32 out of the 45 OXPHOS complexe I subunits The GI numbers 17981862, 21361822 and 38524585 do not match any UniProtKB IDs. The appropriate UniProtKB IDs are respectively P03905, Q9P0J0 and O75251 which match 278, 9 and 7 different GI numbers. Pearson's correlations between each of these subunits were used to empirically determine a cut-off value of r=0.7, above which profiles retrieved by PCP were considered for further analysis. A protein identified by PCP was considered as a candidate when it had a Pearson's correlation factor of r=0.7 in each BN gel for the template pattern (p<0.0001) and if it had a reported mitochondrial localization or predicted to be mitochondrial by at least two out of five mitochondrial prediction algorithms sdha-sdhb-6 physical association of sdha and sdhb 885006 dhsb_human 885042 unspecified role unspecified role neutral component neutral component dhsa_human 885043 unspecified role unspecified role neutral component neutral component physical association physical association false false false Supplementary table 1, Fig. 2 A and B The authors identified 2 out of the 4 OXPHOS complexe II subunits The GI number 4759080 does not match any UniProtKB ID. The appropriate UniProtKB ID is P31040 and matches 11 different GI numbers. Pearson's correlations between each of these subunits were used to empirically determine a cut-off value of r=0.7, above which profiles retrieved by PCP were considered for further analysis. A protein identified by PCP was considered as a candidate when it had a Pearson's correlation factor of r=0.7 in each BN gel for the template pattern (p<0.0001) and if it had a reported mitochondrial localization or predicted to be mitochondrial by at least two out of five mitochondrial prediction algorithms uqcr10-5 physical association of UQCRFS1, UQCRB, UCRC, UQCRC1, UQCRC2 and UQCRQ 885006 qcr9_human 885044 unspecified role unspecified role neutral component neutral component qcr8_human 885045 unspecified role unspecified role neutral component neutral component qcr7_human 885046 unspecified role unspecified role neutral component neutral component qcr1_human 885047 unspecified role unspecified role neutral component neutral component ucri_human 885048 unspecified role unspecified role neutral component neutral component qcr2_human 885049 unspecified role unspecified role neutral component neutral component physical association physical association false false false Supplementary table 1, Fig. 2 A and B The authors identified 6 out of the 11 OXPHOS complexe III subunits The GI number 5174743 doesn't match any uniprot ID. \n The appropriate uniprot ID is P47985 and matches 9 different GI numbers. cox4i1-8 physical association of COX4I1, COX6B1, COX7A2, COX7C, COX5A, COX6C, COX5B and COX2 885006 cox2_human 885050 unspecified role unspecified role neutral component neutral component cox5b_human 885051 unspecified role unspecified role neutral component neutral component cx7a2_human 885052 unspecified role unspecified role neutral component neutral component cox6c_human 885053 unspecified role unspecified role neutral component neutral component cox41_human 885054 unspecified role unspecified role neutral component neutral component cox5a_human 885055 unspecified role unspecified role neutral component neutral component cx6b1_human 885056 unspecified role unspecified role neutral component neutral component cox7c_human 885057 unspecified role unspecified role neutral component neutral component physical association physical association false false false Supplementary table 1, Fig. 2 A and B The authors identified 8 out of the 13 OXPHOS complexe IV subunits The GI numbers 4758038 does not match any UniProtKB ID. The appropriate UniProtKB ID is P20674 and matches 9 different GI numbers. atp5a1-10 physical association of ATP5J2, ATP5H, ATP5I, ATP5F1, ATP5B, ATP5A1, ATP5C1, ATP5D, ATP5J, ATP5L and ATP5S 885006 atpa_human 885058 unspecified role unspecified role neutral component neutral component atpg_human 885059 unspecified role unspecified role neutral component neutral component atp5j_human 885060 unspecified role unspecified role neutral component neutral component atpk_human 885061 unspecified role unspecified role neutral component neutral component atp5h_human 885062 unspecified role unspecified role neutral component neutral component atpd_human 885063 unspecified role unspecified role neutral component neutral component atp5s_human 885064 unspecified role unspecified role neutral component neutral component atpb_human 885065 unspecified role unspecified role neutral component neutral component atp5l_human 885066 unspecified role unspecified role neutral component neutral component at5f1_human 885067 unspecified role unspecified role neutral component neutral component atp5i_human 885068 unspecified role unspecified role neutral component neutral component physical association physical association false false false Supplementary table 1, Fig. 2 A and B The authors identified 11 out of the 17 OXPHOS complexe V subunits mt_nd1-31 physical association of several NADH:ubiquinone oxidoreductase I subunits with c3orf60, c3orf66, dhx30, vlcad and cds2 885007 ndua7_human 885032 unspecified role unspecified role neutral component neutral component ndua4_human 885010 unspecified role unspecified role neutral component neutral component ndua9_human 885034 unspecified role unspecified role neutral component neutral component nduab_human 885029 unspecified role unspecified role neutral component neutral component ndua6_human 885036 unspecified role unspecified role neutral component neutral component nduba_human 885013 unspecified role unspecified role neutral component neutral component ndus2_human 885031 unspecified role unspecified role neutral component neutral component ndua5_human 885041 unspecified role unspecified role neutral component neutral component ndus5_human 885037 unspecified role unspecified role neutral component neutral component ndubb_human 885019 unspecified role unspecified role neutral component neutral component nduc2_human 885020 unspecified role unspecified role neutral component neutral component nduv2_human 885017 unspecified role unspecified role neutral component neutral component ndus8_human 885021 unspecified role unspecified role neutral component neutral component nu4m_human 885016 unspecified role unspecified role neutral component neutral component nduaa_human 885015 unspecified role unspecified role neutral component neutral component ndus7_human 885027 unspecified role unspecified role neutral component neutral component nu1m_human 885012 unspecified role unspecified role neutral component neutral component ndua2_human 885039 unspecified role unspecified role neutral component neutral component ndus6_human 885024 unspecified role unspecified role neutral component neutral component ndus3_human 885040 unspecified role unspecified role neutral component neutral component nduv3_human 885035 unspecified role unspecified role neutral component neutral component ndub3_human 885018 unspecified role unspecified role neutral component neutral component nduac_human 885033 unspecified role unspecified role neutral component neutral component ndus4_human 885025 unspecified role unspecified role neutral component neutral component ndub5_human 885011 unspecified role unspecified role neutral component neutral component ndub7_human 885014 unspecified role unspecified role neutral component neutral component nduad_human 885028 unspecified role unspecified role neutral component neutral component ndua8_human 885022 unspecified role unspecified role neutral component neutral component ndub9_human 885023 unspecified role unspecified role neutral component neutral component ndub8_human 885038 unspecified role unspecified role neutral component neutral component ndus1_human 885030 unspecified role unspecified role neutral component neutral component nduv1_human 885026 unspecified role unspecified role neutral component neutral component physical association physical association false false false Supplementary table 1, Fig. 2 A and B, Table 1 and supporting information Fig. 3 The authors identified 32 out of the 45 OXPHOS complexe I subunits The GI numbers 17981862, 21361822 and 38524585 do not match any UniProtKB IDs. The appropriate UniProtKB IDs are respectively P03905, Q9P0J0 and O75251 and match respectively 278, 9 and 7 different GI numbers. sdha-sdhb physical association of sdha and sdhb 885007 dhsa_human 885043 unspecified role unspecified role neutral component neutral component dhsb_human 885042 unspecified role unspecified role neutral component neutral component physical association physical association false false false Supplementary table 1, Fig. 2 A and B The authors identified 2 out of the 4 OXPHOS complexe II subunits The GI number 4759080 does not match any UniProtKB ID. The appropriate UniProtKB ID is P31040 and matches 11 different GI numbers. uqcr10-6 physical association of UQCRFS1, UQCRB, UCRC, UQCRC1, UQCRC2 and UQCRQ 885007 qcr7_human 885046 unspecified role unspecified role neutral component neutral component qcr1_human 885047 unspecified role unspecified role neutral component neutral component qcr2_human 885049 unspecified role unspecified role neutral component neutral component ucri_human 885048 unspecified role unspecified role neutral component neutral component qcr9_human 885044 unspecified role unspecified role neutral component neutral component qcr8_human 885045 unspecified role unspecified role neutral component neutral component physical association physical association false false false Supplementary table 1, Fig. 2 A and B The authors identified 6 out of the 11 OXPHOS complexe III subunits The GI number 5174743 doesn't match any UniProtKB ID. The appropriate UniProtKB ID is P47985 and matches 9 different GI numbers. cox4i1-7 physical association of COX4I1, COX6B1, COX7A2, COX7C, COX5A, COX6C, COX5B and COX2 885007 cox2_human 885050 unspecified role unspecified role neutral component neutral component cox7c_human 885057 unspecified role unspecified role neutral component neutral component cox5a_human 885055 unspecified role unspecified role neutral component neutral component cox5b_human 885051 unspecified role unspecified role neutral component neutral component cx6b1_human 885056 unspecified role unspecified role neutral component neutral component cox41_human 885054 unspecified role unspecified role neutral component neutral component cox6c_human 885053 unspecified role unspecified role neutral component neutral component cx7a2_human 885052 unspecified role unspecified role neutral component neutral component physical association physical association false false false Supplementary table 1, Fig. 2 A and B The authors identified 8 out of the 13 OXPHOS complexe IV subunits The GI numbers 4758038 does not match any UniProtKB ID. The appropriate UniProtKB ID is P20674 and matches 9 different GI numbers. atp5a1-10 physical association of ATP5J2, ATP5H, ATP5I, ATP5F1, ATP5B, ATP5A1, ATP5C1, ATP5D, ATP5J, ATP5L and ATP5S 885007 atpa_human 885058 unspecified role unspecified role neutral component neutral component atp5j_human 885060 unspecified role unspecified role neutral component neutral component atpd_human 885063 unspecified role unspecified role neutral component neutral component atp5i_human 885068 unspecified role unspecified role neutral component neutral component atp5l_human 885066 unspecified role unspecified role neutral component neutral component at5f1_human 885067 unspecified role unspecified role neutral component neutral component atpg_human 885059 unspecified role unspecified role neutral component neutral component atp5h_human 885062 unspecified role unspecified role neutral component neutral component atpb_human 885065 unspecified role unspecified role neutral component neutral component atpk_human 885061 unspecified role unspecified role neutral component neutral component atp5s_human 885064 unspecified role unspecified role neutral component neutral component physical association physical association false false false Supplementary table 1, Fig. 2 A and B The authors identified 11 out of the 17 OXPHOS complexe V subunits ndufs2-ndufs3 physcal association of NDUFS2 with NDUFS3 885008 ndus2_human 885031 unspecified role unspecified role neutral component neutral component ndus3_human 885040 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig. 3. B The subunits NDFUS2 and NDUFS3 seem to be found in 6 different complexes. (the mitochondrial respiratory chain complex I and 5 different holocomplexes or assembly intermediates) primary antibodies against NDUFS2 and NDUFS3 for the immunoblot ndufaf3-3 physcal association of NDUFS2, NDUFS3, C3orf60 and C3orf66 885008 nduf3_human 885069 unspecified role unspecified role neutral component neutral component nduf4_human 885070 unspecified role unspecified role neutral component neutral component ndus3_human 885040 unspecified role unspecified role neutral component neutral component ndus2_human 885031 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig. 4. A, B and C The subunits NDFUS2 and NDUFS3 and the proteins C3orf60 and C3orf66 seem to be found in 4 different complexes. primary antibodies against NDUFS2, NDUFS3, C3orf60 and C3orf66 for the immunoblot ndufs2-ndufs3 physcal association of NDUFS2 with NDUFS3 885009 ndus3_human 885040 unspecified role unspecified role neutral component neutral component ndus2_human 885031 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig. 3. B The subunits NDFUS2 and NDUFS3 seem to be found in 6 different complexes. (the mitochondrial respiratory chain complex I and 5 different holocomplexes or assembly intermediates) primary antibodies against NDUFS2 and NDUFS3 for the immunoblot ndufaf3-3 physcal association of NDUFS2, NDUFS3, C3orf60 and C3orf66 885009 nduf3_human 885069 unspecified role unspecified role neutral component neutral component ndus3_human 885040 unspecified role unspecified role neutral component neutral component nduf4_human 885070 unspecified role unspecified role neutral component neutral component ndus2_human 885031 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig. 4. A, B and C The subunits NDFUS2 and NDUFS3 and the proteins C3orf60 and C3orf66 seem to be found in 4 different complexes. primary antibodies against NDUFS2, NDUFS3, C3orf60 and C3orf66 for the immunoblot