IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kalaszczyns-2009-1 Cyclin a is redundant in fibroblasts but essential in hematopoietic and embryonic stem cells. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kalaszczynska I., Geng Y., Iino T., Mizuno S., Choi Y., Kondratiuk I., Silver DP., Wolgemuth DJ., Akashi K., Sicinski P. Apoptosis - Interactions involving proteins with a function related to apoptosis peter_sicinski@dfci.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 9 imex curation kalaszczyns-2009-3 Cyclin a is redundant in fibroblasts but essential in hematopoietic and embryonic stem cells. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kalaszczynska I., Geng Y., Iino T., Mizuno S., Choi Y., Kondratiuk I., Silver DP., Wolgemuth DJ., Akashi K., Sicinski P. Apoptosis - Interactions involving proteins with a function related to apoptosis peter_sicinski@dfci.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 9 imex curation kalaszczyns-2009-2 Cyclin a is redundant in fibroblasts but essential in hematopoietic and embryonic stem cells. mouse-bone-marrow Mouse bone marrow bone_marrow bone marrow anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kalaszczynska I., Geng Y., Iino T., Mizuno S., Choi Y., Kondratiuk I., Silver DP., Wolgemuth DJ., Akashi K., Sicinski P. Apoptosis - Interactions involving proteins with a function related to apoptosis peter_sicinski@dfci.harvard.edu Cell (0092-8674) 2009 Only protein-protein interactions 9 imex curation cdk2_mouse Cyclin-dependent kinase 2 Cdk2 Cell division protein kinase 2 Cdkn2 protein protein mouse Mus musculus Mouse MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMHLVCTQHHAKCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVSAPHPVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL ccna2_mouse Cyclin-A2 Ccna2 Ccna Cyca Cyca2 protein protein mouse Mus musculus Mouse MPGTSRHSGRDAGSALLSLHQEDQENVNPEKLAPAQQPRAQAVLKAGNVRGPAPQQKLKTRRVAPLKDLPINDEHVTAGPSWKAVSKQPAFTIHVDEAEETQKRPAELKETECEDALAFNAAVSLPGARKPLTPLDYPMDGSFESPHAMDMSIVLEDKPVNVNEVPDYQEDIHTYLREMEVKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQFLTQYFLHLQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQSWPESLAQQTGYTLESLKPCLVDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPETLSV ccne1_mouse G1/S-specific cyclin-E1 Ccne1 Ccne protein protein mouse Mus musculus Mouse MPRERDSTDHSNMKEEGGSDLSVRSRKRKANVAVFLQDPDEEIAKIDKTVKSEDSSQPWDDNSACVDPCSFIPTPNKEEDNELEYPRTAFQPRKIRPPRASPLPVLNWGNREEVWRIMLNKEKTYLRDEHFLQRHPLLQARMRAVLLDWLMEVCEVYKLHRETFYLAQDFFDRYMASQHNIIKTLLQLIGISALFIASKLEEIYPPKLHQFAYVTDGACSGDEILTMELMMMKALKWRLSPLTIVSWLNVYVQVAYVNDTGEVLMPQYPQQVFVQIAELLDLCVLDVGCLEFPYGVLAASALYHFSSLELMQKVSGYQWCDIEKCVKWMVPFAMVIREMGSSKLKHFRGVPMEDSHNIQTHTNSLDLLDKAQAKKAILSEQNRISPPPSVVLTPPPSSKKQSSEQETE cdk1_mouse Cyclin-dependent kinase 1 p34 protein kinase Cell division protein kinase 1 Cdk1 Cdc2a Cdc2 Cell division control protein 2 homolog Cdkn1 protein protein mouse Mus musculus Mouse MEDYIKIEKIGEGTYGVVYKGRHRVTGQIVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLHQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLVYDPAKRISGKMALKHPYFDDLDNQIKKM cdk2-ccna2-1 Interaction between Cdk2 and Ccna2 demonstrated by coimmunopreciptiation 838190 n/a 838193 unspecified role unspecified role bait bait n/a 838194 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7E cdk2-ccne1-5 Interaction between Cdk2 and Ccne1 demonstrated by coimmunopreciptiation 838190 n/a 838193 unspecified role unspecified role bait bait n/a 838195 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7E, 7G cdk1-ccne1-1 Interaction between Cdk1 and Ccne1 demonstrated by coimmunopreciptiation 838190 n/a 838196 unspecified role unspecified role bait bait n/a 838195 unspecified role unspecified role prey prey physical association physical association false false false 7G cdk1-ccna2-1 Interaction between Cdk1 and Ccna2 demonstrated by coimmunopreciptiation 838190 n/a 838194 unspecified role unspecified role prey prey n/a 838196 unspecified role unspecified role bait bait physical association physical association false false false Fig. 7E cdk2-ccne1-6 Interaction between Cdk2 and Ccne1 demonstrated by coimmunopreciptiation 838191 n/a 838195 unspecified role unspecified role prey prey n/a 838193 unspecified role unspecified role bait bait physical association physical association false false false Fig. 7E, 7G cdk2-ccna2-3 Interaction between Cdk2 and Ccna2 demonstrated by coimmunopreciptiation 838191 n/a 838194 unspecified role unspecified role prey prey n/a 838193 unspecified role unspecified role bait bait physical association physical association false false false Fig. 7E cdk1-ccne1-2 Interaction between Cdk1 and Ccne1 demonstrated by coimmunopreciptiation 838191 n/a 838196 unspecified role unspecified role bait bait n/a 838195 unspecified role unspecified role prey prey physical association physical association false false false 7G cdk1-ccna2-2 Interaction between Cdk1 and Ccna2 demonstrated by coimmunopreciptiation 838191 n/a 838196 unspecified role unspecified role bait bait n/a 838194 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7E cdk2-ccna2-2 Interaction between Cdk2 and Ccna2 demonstrated by coimmunopreciptiation 838192 n/a 838194 unspecified role unspecified role prey prey n/a 838193 unspecified role unspecified role bait bait physical association physical association false false false Fig. 7E The Cyclin A2 observed in this interaction is described as a shorter (38kDa) form than normally observed but this isoform is not present in UniProtKB.