UniProt UniProt http://www.uniprot.org eliseev-2009-1 Cyclophilin D interacts with Bcl2 and exerts an anti-apoptotic effect. rat-liver rattus norvegicus liver Rat liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Eliseev R.A., Malecki J., Lester T., Zhang Y., Humphrey J., Gunter T.E. Apoptosis - Interactions involving proteins with a function related to apoptosis The association of endogenous proteins was also shown in mitochondrial extracts from rat hearts, human HEK293T, Saos2 and HL60 cells, and whole cell lysates from Saos2 and HEK293T cells (mentioned but data not shown in this publication). Roman_Eliseev@urmc.rochester.edu J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation eliseev-2009-2 Cyclophilin D interacts with Bcl2 and exerts an anti-apoptotic effect. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Eliseev R.A., Malecki J., Lester T., Zhang Y., Humphrey J., Gunter T.E. Apoptosis - Interactions involving proteins with a function related to apoptosis The association of endogenous proteins was also shown in mitochondrial extracts from rat hearts, human HEK293T, Saos2 and HL60 cells, and whole cell lysates from Saos2 and HEK293T cells (mentioned but data not shown in this publication). Roman_Eliseev@urmc.rochester.edu J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation eliseev-2009-3 Cyclophilin D interacts with Bcl2 and exerts an anti-apoptotic effect. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Eliseev R.A., Malecki J., Lester T., Zhang Y., Humphrey J., Gunter T.E. Apoptosis - Interactions involving proteins with a function related to apoptosis The association of endogenous proteins was also shown in mitochondrial extracts from rat hearts, human HEK293T, Saos2 and HL60 cells, and whole cell lysates from Saos2 and HEK293T cells (mentioned but data not shown in this publication). Roman_Eliseev@urmc.rochester.edu J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation ppif_rat Peptidyl-prolyl cis-trans isomerase F, mitochondrial Cyclophilin D Ppif Cyclophilin F Rotamase F protein protein rat Rattus norvegicus (Rat) Rat MLALRCGPRLLGLLSGPRSAPLLLSTTRTCSDGGARGANSSSQNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTSKKIVITDCGQLS bcl2_rat Apoptosis regulator Bcl-2 Bcl2 Bcl-2 protein protein rat Rattus norvegicus (Rat) Rat MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK ppif_human Peptidyl-prolyl cis-trans isomerase F, mitochondrial PPIF CYP3 Cyclophilin F Rotamase F Cyclophilin D Mitochondrial cyclophilin protein protein human Homo sapiens Human MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS bcl2-ppif 1349749 n/a 1349752 unspecified role unspecified role prey prey n/a 1349753 unspecified role unspecified role bait bait physical association physical association false false false 1A, 2B, 2D cyclosporin A Calcium has no effect on the association bcl2-ppif-1 1349750 n/a 1349754 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1349752 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep rat-liver rattus norvegicus liver Rat liver liver Mitochondrial protein extracts have been used. physical association physical association false false false 1B, 2C, 2E Calcium had no affect on the pull-down. Cyclosporine A bcl2-ppif-2 1349751 n/a 1349755 unspecified role unspecified role prey prey n/a 1349754 unspecified role unspecified role bait bait physical association physical association false false false 1D