IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ schafer-2009-2 KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 schafer-2009-5 KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 schafer-2009-6 KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 schafer-2009-9 Co-localisation: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 schafer-2009-1 KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 schafer-2009-10 KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. mouse-bone-marrow Mouse bone marrow bone_marrow bone marrow fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 schafer-2009-11 KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. mouse-brain-hippocampus Mus musculus brain_hippocampus brain hippocampus confocal microscopy confocal microscopy immunostaining immunostaining Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 schafer-2009-4 KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Linear 5-20%sucrose density gradient. Additional detail of constructs supplied by the author. Montenarh@uks.eu Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 schafer-2009-7 KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. in vitro In vitro pull down pull down polyclonal western polyclonal antibody western blot polyclonal western Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 schafer-2009-8 SPR and KIF5C: a new binding partner for protein kinase CK2 with a preference for the CK2alpha' subunit. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Schafer B., Gotz C., Dudek J., Hessenauer A., Matti U., Montenarh M. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional detail of constructs supplied by the author. Montenarh@uks.eu Human testis cDNA Cell. Mol. Life Sci. (1420-682X) 2009 csk22_human Casein kinase II subunit alpha' CSNK2A2 CK2A2 protein protein human Homo sapiens Human MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR csk2b_human Casein kinase II subunit beta Phosvitin Protein G5a CSNK2B CK2N G5A protein protein human Homo sapiens Human MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR csk21_human Casein kinase II subunit alpha CSNK2A1 CK2A1 protein protein human Homo sapiens Human MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ kif5c_human Kinesin heavy chain isoform 5C Kinesin heavy chain neuron-specific 2 KIF5C KIAA0531 NKHC2 protein protein human Homo sapiens Human MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKTLKNVIQHLEMELNRWRNGEAVPEDEQISAKDQKNLEPCDNTPIIDNIAPVVAGISTEEKEKYDEEISSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAAKDEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELSNHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKSLVNRSKQLESAQMDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQKRRQLEESQDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEMKKALEQQMESHREAHQKQLSRLRDEIEEKQKIIDEIRDLNQKLQLEQEKLSSDYNKLKIEDQEREMKLEKLLLLNDKREQAREDLKGLEETVSRELQTLHNLRKLFVQDLTTRVKKSVELDNDDGGGSAAQKQKISFLENNLEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQEVDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAIRGGGGSSSNSTHYQK ck2_substrate Sequence:RRRDDDSDDD protein protein chemical synthesis Chemical synthesis (Chemical synthesis) RRRDDDSDDD An amino acid sequence which is not represented in UniProt kif5c_mouse Kinesin heavy chain isoform 5C Kif5c Nkhc2 Kinesin heavy chain neuron-specific 2 protein protein mouse Mus musculus Mouse MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVLQHLEMELNRWRNGEAVPEDEQISAKDQKSLEPCDNTPIIDNITPVVDGISAEKEKYDEEITSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAAKDEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELSNHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKSLVNRSKQLESAQMDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQKRRQLEESQDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEVKKALEQQMESHREAHQKQLSRLRDEIEEKQRIIDEIRDLNQKLQLEQERLSSDYNKLKIEDQEREVKLEKLLLLNDKREQAREDLKGLEETVSRELQTLHNLRKLFVQDLTTRVKKSVELDSDDGGGSAAQKQKISFLENNLEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQEVDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAVRGGGGGSSNSTHYQK csk21_mouse Casein kinase II subunit alpha Csnk2a1 Ckiia protein protein mouse Mus musculus Mouse MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMSSTSMAGGSTPVSSANMMSGISSVPTPSPLGPLAGSPVIAAANSLGIPVPAAAGAQQ csk22_mouse Casein kinase II subunit alpha' Csnk2a2 protein protein mouse Mus musculus Mouse MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGQDNYDQLVRIAKVLGTDELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCAENTVLSSGLTAAR csnk2a2-csnk2b-1 interaction between CSNK2A2 and CSNK2B 865648 n/a 865658 unspecified role unspecified role bait bait n/a 865659 unspecified role unspecified role prey prey physical association physical association false false false Table 1. csnk2a1-kif5c-3 interaction between Casein kinase 2a1 and Kinesin heavy chain isoform 5C 865648 n/a 865660 unspecified role unspecified role bait bait n/a 865661 unspecified role unspecified role prey prey n terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1. csnk2a2-kif5c-1 interaction between Casein kinase 2a 2 and Kinesin heavy chain isoform 5C 865648 n/a 865661 unspecified role unspecified role prey prey n terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 865658 unspecified role unspecified role bait bait physical association physical association false false false Table 1. csk2a1-csk2b interaction between CSNK2A1 and CSNK2B 865648 n/a 865660 unspecified role unspecified role bait bait n/a 865659 unspecified role unspecified role prey prey physical association physical association false false false Table 1. csnk2a2-ck2_subst 865649 n/a 865661 competitor competitor competitor neutral component neutral component human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells n/a 865662 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) n/a 865658 enzyme enzyme neutral component neutral component human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells phosphorylation phosphorylation reaction phosphorylation false false false Fig 7. Increasing the concentration of Kinesin heavy chain isoform 5C led to a reduction of kinase activity in a dose dependent manner. The effect is greater using Casein kinase II subunit alpha' (CSNK2A2) rather than Casein kinase II subunit alpha (CSNK2A1). csnk2a1-ck2_subst-1 865649 n/a 865661 competitor competitor competitor neutral component neutral component human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells n/a 865662 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) n/a 865660 enzyme enzyme neutral component neutral component human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells phosphorylation phosphorylation reaction phosphorylation false false false Fig 7. Increasing the concentration of Kinesin heavy chain isoform 5C led to a reduction of kinase activity in a dose dependent manner. The effect is greater using Casein kinase II subunit alpha' (CSNK2A2) rather than Casein kinase II subunit alpha (CSNK2A1). csnk2a2-ck2_subst-1 865649 n/a 865658 enzyme enzyme neutral component neutral component human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells n/a 865662 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) phosphorylation phosphorylation reaction phosphorylation false false false Fig 7. Increasing the concentration of Kinesin heavy chain isoform 5C led to a reduction of kinase activity in a dose dependent manner. The effect is greater using Casein kinase II subunit alpha' (CSNK2A2) rather than Casein kinase II subunit alpha (CSNK2A1). csnk2a1-ck2_subst-2 865649 n/a 865662 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) n/a 865660 enzyme enzyme neutral component neutral component human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells phosphorylation phosphorylation reaction phosphorylation false false false Fig 7. Increasing the concentration of Kinesin heavy chain isoform 5C led to a reduction of kinase activity in a dose dependent manner. The effect is greater using Casein kinase II subunit alpha' (CSNK2A2) rather than Casein kinase II subunit alpha (CSNK2A1). csnk2b-kif5c IP using polyclonal antibodies to specific CK2 subunits. 865650 n/a 865659 unspecified role unspecified role bait bait n/a 865661 unspecified role unspecified role prey prey physical association physical association false false false Fig 4. There is a discrepancy between the figure legend (antibody H1) and the text (antibody #976) regarding the antibody used to detect KIF5C. csnk2a1-kif5c-8 IP using polyclonal antibodies to specific CK2 subunits. 865650 n/a 865661 unspecified role unspecified role prey prey n/a 865660 unspecified role unspecified role bait bait physical association physical association false false false Fig 4. There is a discrepancy between the figure legend (antibody H1) and the text (antibody #976) regarding the antibody used to detect KIF5C. csnk2a2-kif5c-9 IP using polyclonal antibodies to specific CK2 subunits. 865650 n/a 865658 unspecified role unspecified role bait bait n/a 865661 unspecified role unspecified role prey prey physical association physical association false false false Fig 4. There is a discrepancy between the figure legend (antibody H1) and the text (antibody #976) regarding the antibody used to detect KIF5C. kif5c-csnk2a2-1 865651 n/a 865661 unspecified role unspecified role neutral component neutral component n/a 865658 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 8. kif5c-csnk2a1-2 865651 n/a 865660 unspecified role unspecified role neutral component neutral component n/a 865661 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 8. kif5c-csnk2b 865651 n/a 865661 unspecified role unspecified role neutral component neutral component n/a 865659 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 8. csnk2a1-kif5c-6 interaction between Casein kinase 2a1 and Kinesin heavy chain isoform 5C 865652 n/a 865661 unspecified role unspecified role prey prey n/a 865660 unspecified role unspecified role bait bait physical association physical association false false false CSNK2A1 binds to the to nucleotides 762-1047 of KIF5C. Fig 1. csnk2a2-kif5c-2 interaction between Casein kinase 2a 2 and Kinesin heavy chain isoform 5C 865652 n/a 865660 unspecified role unspecified role bait bait n/a 865658 unspecified role unspecified role prey prey physical association physical association false false false Fig 1. kif5c-csnk2a1 865653 n/a 865663 unspecified role unspecified role neutral component neutral component n/a 865664 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 9. kif5c-csnk2a2-3 865653 n/a 865663 unspecified role unspecified role neutral component neutral component n/a 865665 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 9. csnk2a1-kif5c-12 865654 n/a 865664 unspecified role unspecified role neutral component neutral component n/a 865663 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 10. csnk2a2-kif5c-13 865654 n/a 865665 unspecified role unspecified role neutral component neutral component n/a 865663 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 10. csnk2a1-kif5c-1 865655 n/a 865661 unspecified role unspecified role neutral component neutral component n/a 865660 unspecified role unspecified role neutral component neutral component n/a 865658 unspecified role unspecified role neutral component neutral component n/a 865659 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig 3A kif5c-csnk2a2-2 Pull down of KIF5C using CK2 subunit. 865656 n/a 865658 unspecified role unspecified role prey prey human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells n/a 865661 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells direct interaction direct interaction false false false Fig 5. kif5c-csnk2a2 KIF5C only interacts with csnk2a2 865657 n/a 865658 unspecified role unspecified role prey prey human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells n/a 865661 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Fig 6.