UniProt UniProt http://www.uniprot.org ivanchuk-2008-3 p14ARF interacts with DAXX: effects on HDM2 and p53. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis COS-7 cells have been transfected with FLAG-DAXX and myc-CDKN2A/ARF. james.rutka@sickkids.ca human fetal brain MATCHmaker cDNA library Cell Cycle (1538-4101) 2008 Only protein-protein interactions imex curation ivanchuk-2008-5 p14ARF interacts with DAXX: effects on HDM2 and p53. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis james.rutka@sickkids.ca human fetal brain MATCHmaker cDNA library Cell Cycle (1538-4101) 2008 Only protein-protein interactions imex curation ivanchuk-2008-1 p14ARF interacts with DAXX: effects on HDM2 and p53. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis james.rutka@sickkids.ca human fetal brain MATCHmaker cDNA library Cell Cycle (1538-4101) 2008 Only protein-protein interactions imex curation ivanchuk-2008-2 p14ARF interacts with DAXX: effects on HDM2 and p53. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis COS-7 cells have been transfected with FLAG-DAXX and cell lysates have been incubated with GST-CDKN2A/ARF. james.rutka@sickkids.ca human fetal brain MATCHmaker cDNA library Cell Cycle (1538-4101) 2008 Only protein-protein interactions imex curation ivanchuk-2008-4 p14ARF interacts with DAXX: effects on HDM2 and p53. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis U2OS cells have been transfected with FLAG-DAXX and myc-CDKN2A/ARF. james.rutka@sickkids.ca human fetal brain MATCHmaker cDNA library Cell Cycle (1538-4101) 2008 Only protein-protein interactions imex curation ivanchuk-2008-6 p14ARF interacts with DAXX: effects on HDM2 and p53. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis james.rutka@sickkids.ca human fetal brain MATCHmaker cDNA library Cell Cycle (1538-4101) 2008 Only protein-protein interactions imex curation ivanchuk-2008-7 p14ARF interacts with DAXX: effects on HDM2 and p53. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis U2OS cells have been transfected with FLAG-DAXX, myc-CDKN2A/ARF and HDM2 plasmids. james.rutka@sickkids.ca human fetal brain MATCHmaker cDNA library Cell Cycle (1538-4101) 2008 Only protein-protein interactions imex curation ivanchuk-2008-8 p14ARF interacts with DAXX: effects on HDM2 and p53. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Ivanchuk SM., Mondal S., Rutka JT. Apoptosis - Interactions involving proteins with a function related to apoptosis U2OS cells have been transfected with FLAG-DAXX, myc-CDKN2A/ARF and HDM2 plasmids. james.rutka@sickkids.ca human fetal brain MATCHmaker cDNA library Cell Cycle (1538-4101) 2008 Only protein-protein interactions imex curation arf_human Tumor suppressor ARF p14ARF CDKN2A CDKN2 MLM Alternative reading frame Cyclin-dependent kinase inhibitor 2A protein protein human Homo sapiens Human MVRRFLVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPSGGAAAAPRRGAQLRRPRHSHPTRARRCPGGLPGHAGGAAPGRGAAGRARCLGPSARGPG daxx_human Death domain-associated protein 6 DAXX BING2 DAP6 Daxx Fas death domain-associated protein ETS1-associated protein 1 protein protein human Homo sapiens Human MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPSGMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCIPSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD mdm2_human E3 ubiquitin-protein ligase Mdm2 MDM2 p53-binding protein Mdm2 Oncoprotein Mdm2 Double minute 2 protein RING-type E3 ubiquitin transferase Mdm2 protein protein human Homo sapiens Human MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP daxx-cdkn2a 766154 n/a 766162 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 n/a 766163 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 association association false false false 1B and 4 cdkn2a-daxx-3 766154 n/a 766162 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 n/a 766163 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 association association false false false 1B daxx-cdkn2a-1 766155 n/a 766162 unspecified role unspecified role prey prey n/a 766163 unspecified role unspecified role bait bait association association false false false 3B cdkn2a-daxx-6 766155 n/a 766162 unspecified role unspecified role bait bait n/a 766163 unspecified role unspecified role prey prey association association false false false 3A cdkn2a-daxx 766156 n/a 766162 unspecified role unspecified role bait bait n/a 766163 unspecified role unspecified role prey prey physical association physical association false false false no figure cdkn2a-daxx-1 766157 n/a 766162 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 n/a 766163 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) association association false false false 1A cdkn2a-daxx-4 766158 n/a 766162 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference n/a 766163 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference colocalization colocalization false false false 2 cdkn2a-daxx-7 766159 n/a 766162 unspecified role unspecified role neutral component neutral component n/a 766163 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3C daxx-mdm2-5 766160 n/a 766164 unspecified role unspecified role prey prey human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference n/a 766163 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference association association false false false 5A mdm2-cdkn2a-1 766161 n/a 766162 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference n/a 766164 unspecified role unspecified role bait bait human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference association association false false false 5C