IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wang-2008b-2 BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca HeLa cell cDNA Cell (0092-8674) 2008 Only protein-protein interactions 21 imex curation wang-2008b-3 BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis Tagged participants may be identified by an anti-tag western. gordon.shore@mcgill.ca HeLa cell cDNA Cell (0092-8674) 2008 Only protein-protein interactions 21 imex curation wang-2008b-5 BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. mesau-bhk Mesocricetus auratus baby kidney cell line BHK bhk Golden (Syrian) Hamster baby kidney cell line BHK Established from the kidneys of five unsexed, one-day-old hamsters in 1961. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca HeLa cell cDNA Cell (0092-8674) 2008 Only protein-protein interactions 21 imex curation wang-2008b-7 BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca HeLa cell cDNA Cell (0092-8674) 2008 Only protein-protein interactions 21 imex curation wang-2008b-1 BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca HeLa cell cDNA Cell (0092-8674) 2008 Only protein-protein interactions 21 imex curation wang-2008b-9 BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca HeLa cell cDNA Cell (0092-8674) 2008 Only protein-protein interactions 21 imex curation wang-2008b-4 BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. human-kb Homo sapiens oral epithelial carcinoma kb Human oral epithelial carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca HeLa cell cDNA Cell (0092-8674) 2008 Only protein-protein interactions 21 imex curation wang-2008b-6 BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca HeLa cell cDNA Cell (0092-8674) 2008 Only protein-protein interactions 21 imex curation wang-2008b-8 BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca HeLa cell cDNA Cell (0092-8674) 2008 Only protein-protein interactions 21 imex curation wang-2008b-10 BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex. mesau-bhk Mesocricetus auratus baby kidney cell line BHK bhk Golden (Syrian) Hamster baby kidney cell line BHK Established from the kidneys of five unsexed, one-day-old hamsters in 1961. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Wang B., Heath-Engel H., Zhang D., Nguyen N., Thomas DY., Hanrahan JW., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis gordon.shore@mcgill.ca HeLa cell cDNA Cell (0092-8674) 2008 Only protein-protein interactions 21 imex curation bap31_human B-cell receptor-associated protein 31 BCAP31 BAP31 p28 6C6-AG tumor-associated antigen DXS1357E Protein CDM protein protein human Homo sapiens Human MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE sc61b_human Protein transport protein Sec61 subunit beta SEC61B protein protein human Homo sapiens Human MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS tram1_human Translocating chain-associated membrane protein 1 TRAM1 TRAM protein protein human Homo sapiens Human MAIRKKSTKSPPVLSHEFVLQNHADIVSCVAMVFLLGLMFEITAKASIIFVTLQYNVTLPATEEQATESVSLYYYGIKDLATVFFYMLVAIIIHAVIQEYMLDKINRRMHFSKTKHSKFNESGQLSAFYLFACVWGTFILISENYISDPTILWRAYPHNLMTFQMKFFYISQLAYWLHAFPELYFQKTKKEDIPRQLVYIGLYLFHIAGAYLLNLNHLGLVLLVLHYFVEFLFHISRLFYFSNEKYQKGFSLWAVLFVLGRLLTLILSVLTVGFGLARAENQKLDFSTGNFNVLAVRIAVLASICVTQAFMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVNGTLTSNVADSPRNKKEKSS cftr_human Cystic fibrosis transmembrane conductance regulator CFTR ABCC7 cAMP-dependent chloride channel ATP-binding cassette sub-family C member 7 Channel conductance-controlling ATPase protein protein human Homo sapiens Human MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRELASKKNPKLINALRRCFFWRFMFYGIFLYLGEVTKAVQPLLLGRIIASYDPDNKEERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVALLMGLIWELLQASAFCGLGFLIVLALFQAGLGRMMMKYRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQTELKLTRKAAYVRYFNSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRMAVTRQFPWAVQTWYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAFWEEGFGELFEKAKQNNNNRKTSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEKRKNSILNPINSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVLNLMTHSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYSRRLSQETGLEISEEINEEDLKECFFDDMESIPAVTTWNTYLRYITVHKSLIFVLIWCLVIFLAEVAASLVVLWLLGNTPLQDKGNSTHSRNNSYAVIITSTSSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAPMSTLNTLKAGGILNRFSKDIAILDDLLPLTIFDFIQLLLIVIGAIAVVAVLQPYIFVATVPVIVAFIMLRAYFLQTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEMIFVIFFIAVTFISILTTGEGEGRVGIILTLAMNIMSTLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKKDDIWPSGGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL sc61b_mesau Protein transport protein Sec61 subunit beta protein protein mesau Mesocricetus auratus (Golden hamster) Golden hamster An amino acid sequence which is not represented in UniProt Similar to P60468 a5x380_mesau B-cell receptor-associated protein Bcap31 BAP31 protein protein mesau Mesocricetus auratus (Golden hamster) Golden hamster MSVQWTAVATFLYAEVFAVLLLCIPFISPKRWQKIFKSRLVELVVTYGNTFFVVLIIILVLLVIDAAREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKEAAEDGAKLDVGNTEVKLEENKTLKNDLKKLKDELANTKKKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQASVHGPSAKKEE derl1_mesau_protein Derlin-1 protein protein mesau Mesocricetus auratus (Golden hamster) Golden hamster An amino acid sequence which is not represented in UniProt Similar to Q9BUN8 derl1_human Derlin-1 DERL1 UNQ243/PRO276 Der1-like protein 1 Degradation in endoplasmic reticulum protein 1 DER1 protein protein human Homo sapiens Human MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATFYFPVGPGTGFLYLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQLLMIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ rnf5_human E3 ubiquitin-protein ligase RNF5 RNF5 G16 RING finger protein 5 Protein G16 NG2 RMA1 Ram1 homolog RING-type E3 ubiquitin transferase RNF5 protein protein human Homo sapiens Human MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI bcap31-sec61b-2 Interaction betweeen BCAP31 and SEC61B demonstrated by coimmunopreciptiation 744333 N/A 744343 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 744344 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1C bcap31-sec61b-3 Interaction betweeen BCAP31 and SEC61B demonstrated by coimmunopreciptiation 744333 N/A 744343 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 744344 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1C bcap31-tram1-2 Interaction betweeen BCAP31 and TRAM1 demonstrated by coimmunopreciptiation 744333 N/A 744345 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 744343 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1C bcap31-tram1-3 Interaction betweeen BCAP31 and TRAM1 demonstrated by coimmunopreciptiation 744333 N/A 744345 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 744343 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figs. 1C & 1E bcap31-sec61b-4 Interaction betweeen BCAP31 and SEC61B demonstrated by coimmunopreciptiation 744334 N/A 744344 unspecified role unspecified role prey prey N/A 744343 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1D bcap31-sec61b-7 Interaction betweeen BCAP31 and SEC61B demonstrated by coimmunopreciptiation 744334 N/A 744343 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain greater-than greater-than false N/A 744344 unspecified role unspecified role bait bait physical association physical association false false false Figs. 5A and 7A BCAP31 has two potential caspase-8 cleavage sites and it is impossible to determine which generates the p20 construct from the information given. P51572 transfection Complex also bound Sec61a but it was impossible to determine whether this was SEC61A1 or SEC61A2 bcap31-tram1-4 Interaction betweeen BCAP31 and TRAM1 demonstrated by coimmunopreciptiation 744334 N/A 744343 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain greater-than greater-than false N/A 744345 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5B BCAP31 has two potential caspase-8 cleavage sites and it is impossible to determine which generates the p20 construct from the information given. Q15629; P51572 transfection bcap31-sec61b-6 Interaction betweeen BCAP31, CFTR and SEC61B demonstrated by coimmunopreciptiation 744335 N/A 744346 unspecified role unspecified role prey prey P13569:p.Phe508del mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 744347 unspecified role unspecified role prey prey N/A 744348 unspecified role unspecified role bait bait association association false false false Fig. 2A P13569 transfection derl1-sec61b-1 Interaction betweeen DerL1 and CFTR demonstrated by coimmunopreciptiation 744335 N/A 744349 unspecified role unspecified role bait bait N/A 744346 unspecified role unspecified role prey prey P13569:p.Phe508del mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Supp. Fig. 9 P13569 transfection derl1-sec61b-2 Interaction betweeen DerL1 and CFTR demonstrated by coimmunopreciptiation 744335 N/A 744346 unspecified role unspecified role bait bait P13569:p.Phe508del mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 744349 unspecified role unspecified role prey prey physical association physical association false false false Supp. Fig. 9 P13569 transfection bcap31-cftr-1 Interaction of BCAP31 and CFTR demonstrated by coimmunopreciptiation 744336 N/A 744343 unspecified role unspecified role bait bait N/A 744346 unspecified role unspecified role prey prey P13569:p.Phe508del mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 6G Cells were treated with DERL1 siRNA, resulting in an elevation of CFTRΔF508 levels bcap31-derl1-2 Interaction of BCAP31 and DERL1 demonstrated by coimmunopreciptiation 744336 N/A 744343 unspecified role unspecified role bait bait N/A 744350 unspecified role unspecified role prey prey physical association physical association false false false Fig. 6G Cells were treated with DERL1 siRNA, resulting in an elevation of CFTRΔF508 levels bcap31-derl1-3 Interaction of BCAP31 and DERL1 demonstrated by coimmunopreciptiation 744336 N/A 744343 unspecified role unspecified role prey prey N/A 744350 unspecified role unspecified role bait bait physical association physical association false false false Supp. Fig. 8 Endogenous Derlin-1 associates with endogenous BAP31. bcap31-sec61b-1 Interaction betweeen BCAP31 and SEC61B in the split-ubiquitin system 744337 N/A 744343 unspecified role unspecified role bait bait N/A 744344 unspecified role unspecified role prey prey physical association physical association false false false bcap31-tram1-1 Interaction betweeen BCAP31 and TRAM1 in the split-ubiquitin system 744337 N/A 744343 unspecified role unspecified role bait bait N/A 744345 unspecified role unspecified role prey prey physical association physical association false false false bcap31-tram1-5 Colocalisation of BCAP31 and TRAM1 744338 N/A 744345 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 744343 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Supp. Fig. 2 bcap31-sec61b-8 Colocalisation of BCAP31 and SEC61B 744338 N/A 744344 unspecified role unspecified role prey prey N/A 744343 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Supp. Fig. 2 bcap31-sec61b-5 Interaction betweeen BCAP31 and SEC61B demonstrated by coimmunopreciptiation 744339 N/A 744344 unspecified role unspecified role prey prey N/A 744343 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1D bcap31-derl1-1 Interaction of BCAP31, DERL1 and RNF5 (RMA1) demonstrated by coimmunopreciptiation 744340 N/A 744350 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 744343 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 744351 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 6A bcap31-cftr-2 Interaction of BCAP31 and CFTR demonstrated by coimmunopreciptiation 744341 N/A 744346 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false membrane spanning sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 744343 unspecified role unspecified role bait bait physical association physical association false false false Fig. 7C bcap31-cftr-3 Colocalisation of BCAP31 and CFTR 744342 N/A 744343 unspecified role unspecified role neutral component neutral component N/A 744346 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Supp. Fig. 3