IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ liu-2008-1 CDK1 promotes cell proliferation and survival via phosphorylation and inhibition of FOXO1 transcription factor. in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Liu P., Kao TP., Huang H. Apoptosis - Interactions involving proteins with a function related to apoptosis The Cell Signaling Technology website was consulted for information regarding the purified recombinant GST-cyclin B and GST-CDK1. huang253@umn.edu Oncogene (0950-9232) 2008 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer liu-2008-2 CDK1 promotes cell proliferation and survival via phosphorylation and inhibition of FOXO1 transcription factor. human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu P., Kao TP., Huang H. Apoptosis - Interactions involving proteins with a function related to apoptosis The Cell Signaling Technology website was consulted for information regarding the purified recombinant GST-cyclin B and GST-CDK1. huang253@umn.edu Oncogene (0950-9232) 2008 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer liu-2008-3 CDK1 promotes cell proliferation and survival via phosphorylation and inhibition of FOXO1 transcription factor. human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu P., Kao TP., Huang H. Apoptosis - Interactions involving proteins with a function related to apoptosis The Cell Signaling Technology website was consulted for information regarding the purified recombinant GST-cyclin B and GST-CDK1. huang253@umn.edu Oncogene (0950-9232) 2008 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer liu-2008-4 CDK1 promotes cell proliferation and survival via phosphorylation and inhibition of FOXO1 transcription factor. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Liu P., Kao TP., Huang H. Apoptosis - Interactions involving proteins with a function related to apoptosis The Cell Signaling Technology website was consulted for information regarding the purified recombinant GST-cyclin B and GST-CDK1. huang253@umn.edu Oncogene (0950-9232) 2008 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer liu-2008-5 CDK1 promotes cell proliferation and survival via phosphorylation and inhibition of FOXO1 transcription factor. human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Liu P., Kao TP., Huang H. Apoptosis - Interactions involving proteins with a function related to apoptosis The Cell Signaling Technology website was consulted for information regarding the purified recombinant GST-cyclin B and GST-CDK1. huang253@umn.edu Oncogene (0950-9232) 2008 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer foxo1_human Forkhead box protein O1 FOXO1 FKHR FOXO1A Forkhead box protein O1A Forkhead in rhabdomyosarcoma protein protein human Homo sapiens Human MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG cdk1_human Cyclin-dependent kinase 1 p34 protein kinase Cell division protein kinase 1 CDK1 CDC2 Cell division control protein 2 homolog CDC28A CDKN1 P34CDC2 protein protein human Homo sapiens Human MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM ccnb1_human G2/mitotic-specific cyclin-B1 CCNB1 CCNB protein protein human Homo sapiens Human MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV bim_human_gene Human Bim gene gene gene human Homo sapiens Human cdc2-foxo1 CDC2 (CDK1) phosphorylates FOXO1 in an in vitro kinase assay 733590 N/A 733595 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 733596 enzyme enzyme unspecified role unspecified role human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma phosphorylation phosphorylation reaction phosphorylation false false false 1 B FOXO1 is phosphorylated cdc2-foxo1-1 CDC2 (CDK1) phosphorylates FOXO1 in an in vitro kinase assay 733590 N/A 733597 unspecified role unspecified role ancillary ancillary n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 733596 enzyme enzyme unspecified role unspecified role n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 733595 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q12778:p.Ser249Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false phosphorylation phosphorylation reaction phosphorylation false false false 1 C, E FOXO1 is phosphorylated on Ser249 foxo1-cdc2 FOXO1 coimmunoprecipitates CDC2 (CDK1) in LNCaP lysates 733591 N/A 733596 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 733595 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3 A Q12778; P06493 lysates cdc2-foxo1-2 FOXO1 coimmunoprecipitates with CDC2 (CDK1) in LNCaP lysates 733591 N/A 733595 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 733596 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3 B Q12778; P06493 lysates cdc2-foxo1-3 CDC2 (CDK1) coimmunoprecipitates FOXO1 in LNCaP lysates 733592 N/A 733596 unspecified role unspecified role bait bait N/A 733595 unspecified role unspecified role prey prey physical association physical association false false false 3 C foxo1-cdc2-1 FOXO1 pulls down CDC2 (CDK1) in vitro 733593 N/A 733596 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 733595 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 3 D foxo1-bim FOXO1 binds the Bim promoter 733594 N/A 733595 unspecified role unspecified role bait bait Q12778:p.[Thr24Ala;Ser256Ala;Ser319Ala] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q12778:p.[Thr24Ala;Ser249Ala;Ser256Ala;Ser319Ala] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 733598 unspecified role unspecified role prey prey association association false false false 6 D The binding of FOXO1-A3 (thr24ala/ser256ala/ser319ala) but not FOXO1-A3/ser249ala to the Bim promoter was largely inhibited in cells transfected with CDK1-AF and cyclin B1.