IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ keller-2008-5 Active caspase-1 is a regulator of unconventional protein secretion. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Keller M., Ruegg A., Werner S., Beer HD. Apoptosis - Interactions involving proteins with a function related to apoptosis dietmar.beer@cell.biol.ethz.ch Cell (0092-8674) 2008 Only protein-protein interactions 9 imex curation keller-2008-4 Active caspase-1 is a regulator of unconventional protein secretion. human-cls Homo sapiens fibroblast cell line (GM03318) cls Human fibroblast obtained from patients with Coffin-Lowry Syndrome (CLS). GM03318 (NIGMS Human Genetic Cell Repository) Catalog ID GM03318 (NIGMS Human Genetic Cell Repository) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Keller M., Ruegg A., Werner S., Beer HD. Apoptosis - Interactions involving proteins with a function related to apoptosis Fibroblasts were UVA irradiated. Experiments showed that caspase-1 interacted with FGF-2 through the p20 subunit but the source of FGF2 used could not be traced. dietmar.beer@cell.biol.ethz.ch Cell (0092-8674) 2008 Only protein-protein interactions 9 imex curation keller-2008-1 Active caspase-1 is a regulator of unconventional protein secretion. human-keratinocyte Homo sapiens keratinocyte Keratinocyte anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Keller M., Ruegg A., Werner S., Beer HD. Apoptosis - Interactions involving proteins with a function related to apoptosis dietmar.beer@cell.biol.ethz.ch Cell (0092-8674) 2008 Only protein-protein interactions 9 imex curation keller-2008-2 Active caspase-1 is a regulator of unconventional protein secretion. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Keller M., Ruegg A., Werner S., Beer HD. Apoptosis - Interactions involving proteins with a function related to apoptosis dietmar.beer@cell.biol.ethz.ch Cell (0092-8674) 2008 Only protein-protein interactions 9 imex curation keller-2008-3 Active caspase-1 is a regulator of unconventional protein secretion. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Keller M., Ruegg A., Werner S., Beer HD. Apoptosis - Interactions involving proteins with a function related to apoptosis dietmar.beer@cell.biol.ethz.ch Cell (0092-8674) 2008 Only protein-protein interactions 9 imex curation p29466-pro_0000004522 Caspase-1 subunit p20 CASP1 IL1BC IL1BCE Interleukin-1 beta convertase Interleukin-1 beta-converting enzyme p45 protein protein human Homo sapiens Human NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD 120 297 il1a_human Interleukin-1 alpha IL1A IL1F1 Hematopoietin-1 protein protein human Homo sapiens Human MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA fgf2_human Fibroblast growth factor 2 Basic fibroblast growth factor FGF2 FGFB Heparin-binding growth factor 2 protein protein human Homo sapiens Human MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS casp1_human Caspase-1 Interleukin-1 beta convertase Interleukin-1 beta-converting enzyme p45 CASP1 IL1BC IL1BCE protein protein human Homo sapiens Human MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH il1a-casp1-3 Interaction between IL1A and Casp1 p20 subunit 730836 N/A 730841 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 730842 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false P01583; P29466 transfection Fig. 3B il1a-casp1-6 Interaction between IL1A and Casp1 p20 subunit 730836 N/A 730841 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 730842 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false P01583; P29466 transfection Fig. 3B il1a-casp1-5 Interaction between IL1A and Casp1 p20 subunit 730836 N/A 730842 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 730841 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false P01583; P29466 transfection Fig. 3C il1a-casp1-7 Interaction between IL1A and Casp1 p20 subunit 730836 N/A 730842 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 730841 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false P01583; P29466 transfection Fig. 3C fgf2-casp1-1 Interaction between CASP1 and FGF2 identified by coimmunoprecipitation 730837 N/A 730843 unspecified role unspecified role prey prey N/A 730844 unspecified role unspecified role bait bait physical association physical association false false false Figure 4D fgf2-casp1-2 Interaction between CASP1 and FGF2 identified by coimmunoprecipitation 730837 N/A 730843 unspecified role unspecified role bait bait N/A 730844 unspecified role unspecified role prey prey physical association physical association false false false Figure 4D il1a-casp1-1 Interaction between IL-1A and CASP1 identified by coimmunoprecipitation 730838 N/A 730844 unspecified role unspecified role prey prey N/A 730842 unspecified role unspecified role bait bait physical association physical association false false false Figure 3A 50 mJ/cm2 UVB 30 min il1a-casp1-2 Interaction between IL-1A and CASP1 identified by coimmunoprecipitation 730839 N/A 730844 unspecified role unspecified role prey prey N/A 730842 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3B P01583; P29466 transfection P01583; P29466 overexpressed il1a-casp1-4 Interaction between IL-1A and CASP1 identified by coimmunoprecipitation 730840 N/A 730844 unspecified role unspecified role bait bait N/A 730842 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3B P01583; P29466 transfection