IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kleber-2008-1 Yes and PI3K Bind CD95 to Signal Invasion of Glioblastoma. human-t98g Human caucasian glioblastoma line T98G t98g Human Caucasian glioblastoma T98G anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kleber S., Sancho-Martinez I., Wiestler B., Beisel A., Gieffers C., Hill O., Thiemann M., Mueller W., Sykora J., Kuhn A., Schreglmann N., Letellier E., Zuliani C., Klussmann S., Teodorczyk M., Grone HJ., Ganten TM., Sultmann H., Tuttenberg J., von Deimling A., Regnier-Vigouroux A., Herold-Mende C., Martin-Villalba A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were stimulated with CD95L-T4. The coimmunoprecipitations involving p85 could not be curated as the antibody was not specific for the alpha or the beta form. a.martin-villalba@dkfz.de Cancer Cell (1535-6108) 2008 Only protein-protein interactions 8 imex curation Cancer - Interactions investigated in the context of cancer kleber-2008-2 Yes and PI3K Bind CD95 to Signal Invasion of Glioblastoma. human-ln18 Homo sapiens LN18 glioblastoma cell line ln18 LN18 human glioblastoma cell line The LN-18 cell line was established in 1976 from cells taken from a patient with a right temporal lobe glioma. The cells are poorly differentiated. The cells are negative for glial fibrillary acidic proteins and S100 (S-100) protein. The cells exhibit mutated p53 (TP53) and possible homozygous deletions in the p16 and p14ARF tumor suppressor genes. They have a wild-type PTEN gene. Stimulation of the cells with Fas ligand lead to apoptotic cell death within 16 hours. The cells were also killed by puromycin in a dose dependent manner. Bcl-2 protects these cells from Fas ligand-induced cell death but was shown to have only a small protective effect on puromycin-induced apoptosis. This cell line is used in studies on apoptosis. (Source of this information is the ATCC entry). anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kleber S., Sancho-Martinez I., Wiestler B., Beisel A., Gieffers C., Hill O., Thiemann M., Mueller W., Sykora J., Kuhn A., Schreglmann N., Letellier E., Zuliani C., Klussmann S., Teodorczyk M., Grone HJ., Ganten TM., Sultmann H., Tuttenberg J., von Deimling A., Regnier-Vigouroux A., Herold-Mende C., Martin-Villalba A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were stimulated with CD95L-T4. The coimmunoprecipitations involving p85 could not be curated as the antibody was not specific for the alpha or the beta form. a.martin-villalba@dkfz.de Cancer Cell (1535-6108) 2008 Only protein-protein interactions 8 imex curation Cancer - Interactions investigated in the context of cancer kleber-2008-3 Yes and PI3K Bind CD95 to Signal Invasion of Glioblastoma. human-jurkat Homo sapiens jurkat Human T cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kleber S., Sancho-Martinez I., Wiestler B., Beisel A., Gieffers C., Hill O., Thiemann M., Mueller W., Sykora J., Kuhn A., Schreglmann N., Letellier E., Zuliani C., Klussmann S., Teodorczyk M., Grone HJ., Ganten TM., Sultmann H., Tuttenberg J., von Deimling A., Regnier-Vigouroux A., Herold-Mende C., Martin-Villalba A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were stimulated with CD95L-T4. The coimmunoprecipitations involving p85 could not be curated as the antibody was not specific for the alpha or the beta form. a.martin-villalba@dkfz.de Cancer Cell (1535-6108) 2008 Only protein-protein interactions 8 imex curation Cancer - Interactions investigated in the context of cancer tnr6_human Tumor necrosis factor receptor superfamily member 6 FASLG receptor Apoptosis-mediating surface antigen FAS Apo-1 antigen FAS APT1 TNFRSF6 FAS1 protein protein human Homo sapiens Human MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV yes_human Tyrosine-protein kinase Yes p61-Yes Proto-oncogene c-Yes YES1 YES protein protein human Homo sapiens Human MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIINNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGENL fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD src_human Proto-oncogene tyrosine-protein kinase Src pp60c-src SRC SRC1 Proto-oncogene c-Src protein protein human Homo sapiens Human MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL fas-yes1 Fas coimmunoprecipitates YES1 in T98G lysates 729234 N/A 729237 unspecified role unspecified role bait bait N/A 729238 unspecified role unspecified role prey prey physical association physical association false false false 4 C fas-fadd-1 Fas coimmunopreciptates FADD in T98G lysates 729234 N/A 729239 unspecified role unspecified role prey prey N/A 729237 unspecified role unspecified role bait bait physical association physical association false false false 5 D, 5 E casp8-fas Fas coimmunopreciptates with Caspase-8 in T98G lysates 729234 N/A 729240 unspecified role unspecified role bait bait N/A 729237 unspecified role unspecified role prey prey physical association physical association false false false 5 D fas-src-1 Fas coimmunopreciptates Src in T98G lysates 729234 N/A 729241 unspecified role unspecified role prey prey N/A 729237 unspecified role unspecified role bait bait physical association physical association false false false 4 B CD95L-T4 - Src association decreased at higher concentrations of CD95L-T4. fas-src Fas coimmunopreciptates Src in LN18 lysates 729235 N/A 729241 unspecified role unspecified role prey prey N/A 729237 unspecified role unspecified role bait bait physical association physical association false false false 4 A CD95L-T4 - Src association decreased at higher concentrations of CD95L-T4. fas-fadd Fas coimmunopreciptates FADD in LN18 lysates 729235 N/A 729239 unspecified role unspecified role prey prey N/A 729237 unspecified role unspecified role bait bait physical association physical association false false false 5 D CD95L-T4 - CD95L-T4 treatment increased this interaction. casp8-fas-1 Fas coimmunopreciptates with Caspase-8 in LN18 lysates 729235 N/A 729237 unspecified role unspecified role prey prey N/A 729240 unspecified role unspecified role bait bait physical association physical association false false false 5 D CD95L-T4 - CD95L-T4 treatment increased this interaction. casp8-fas-2 Fas coimmunopreciptates with Caspase-8 in Jurkat J16 lysates 729236 N/A 729240 unspecified role unspecified role bait bait N/A 729237 unspecified role unspecified role prey prey physical association physical association false false false 5 D CD95L-T4 - CD95L-T4 treatment increased this interaction.