IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ chen-2007d-5 Amplitude control of protein kinase C by RINCK, a novel E3 ubiquitin ligase. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chen D., Gould C., Garza R., Gao T., Hampton RY., Newton AC. Apoptosis - Interactions involving proteins with a function related to apoptosis The authors provided the species of origin of all recombinant proteins. anewton@ucsd.edu J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer A mouse embryonic cDNA library was used. chen-2007d-2 Amplitude control of protein kinase C by RINCK, a novel E3 ubiquitin ligase. human-tsa201 Homo sapiens subclone of human embryonic kidney 293 cell line that expresses simian virus 40 T antigen tsa201 Human embryonic kidney cell line subclone of 293 cell line that expresses simian virus 40 T antigen anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chen D., Gould C., Garza R., Gao T., Hampton RY., Newton AC. Apoptosis - Interactions involving proteins with a function related to apoptosis The authors provided the species of origin of all recombinant proteins. anewton@ucsd.edu J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer A mouse embryonic cDNA library was used. chen-2007d-1 Amplitude control of protein kinase C by RINCK, a novel E3 ubiquitin ligase. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Chen D., Gould C., Garza R., Gao T., Hampton RY., Newton AC. Apoptosis - Interactions involving proteins with a function related to apoptosis The authors provided the species of origin of all recombinant proteins. anewton@ucsd.edu A mouse embryonic cDNA library was used. J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer chen-2007d-3 Amplitude control of protein kinase C by RINCK, a novel E3 ubiquitin ligase. human-tsa201 Homo sapiens subclone of human embryonic kidney 293 cell line that expresses simian virus 40 T antigen tsa201 Human embryonic kidney cell line subclone of 293 cell line that expresses simian virus 40 T antigen anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen D., Gould C., Garza R., Gao T., Hampton RY., Newton AC. Apoptosis - Interactions involving proteins with a function related to apoptosis The authors provided the species of origin of all recombinant proteins. anewton@ucsd.edu J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer A mouse embryonic cDNA library was used. chen-2007d-4 Amplitude control of protein kinase C by RINCK, a novel E3 ubiquitin ligase. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Chen D., Gould C., Garza R., Gao T., Hampton RY., Newton AC. Apoptosis - Interactions involving proteins with a function related to apoptosis The authors provided the species of origin of all recombinant proteins. anewton@ucsd.edu J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer A mouse embryonic cDNA library was used. chen-2007d-6 Amplitude control of protein kinase C by RINCK, a novel E3 ubiquitin ligase. human-tsa201 Homo sapiens subclone of human embryonic kidney 293 cell line that expresses simian virus 40 T antigen tsa201 Human embryonic kidney cell line subclone of 293 cell line that expresses simian virus 40 T antigen pull down pull down anti tag immunost anti tag immunostaining anti tag immunost Chen D., Gould C., Garza R., Gao T., Hampton RY., Newton AC. Apoptosis - Interactions involving proteins with a function related to apoptosis The authors provided the species of origin of all recombinant proteins. anewton@ucsd.edu J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer A mouse embryonic cDNA library was used. chen-2007d-7 Amplitude control of protein kinase C by RINCK, a novel E3 ubiquitin ligase. human-tsa201 Homo sapiens subclone of human embryonic kidney 293 cell line that expresses simian virus 40 T antigen tsa201 Human embryonic kidney cell line subclone of 293 cell line that expresses simian virus 40 T antigen anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag immunost anti tag immunostaining anti tag immunost Chen D., Gould C., Garza R., Gao T., Hampton RY., Newton AC. Apoptosis - Interactions involving proteins with a function related to apoptosis The authors provided the species of origin of all recombinant proteins. anewton@ucsd.edu J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer A mouse embryonic cDNA library was used. p68403-2 Protein kinase C beta type Prkcb Pkcb Prkcb1 protein protein rat Rattus norvegicus (Rat) Rat MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEELRQKFERAKIGQGTKAPEEKTANTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFSFVNSEFLKPEVKS Contains a phosphothreonine at position 641. Contains a phosphoserine at position 654. Contains a phosphoserine at position 660. Contains a phosphoserine at position 664. q8wv44-2 E3 ubiquitin-protein ligase TRIM41 TRIM41b TRIM41beta TRIM41 RINCK RING finger-interacting protein with C kinase Tripartite motif-containing protein 41 RINCK1 RING-type E3 ubiquitin transferase TRIM41 protein protein human Homo sapiens Human MAAVAMTPNPVQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGGEDEEDRDELDREEEEEDGEEEEVEAVGAGAGWDTPMRDEDYEGDMEEEVEEEEEGVFWTSGMSRSSWDNMDYVWEEEDEEEDLDYYLGDMEEEDLRGEDEEDEEEVLEEVEEEDLDPVTPLPPPPAPRRCFTCPQCRKSFPRRSFRPNLQLANMVQVIRQMHPTPGRGSRVTDQGICPKHQEALKLFCEVDEEAICVVCRESRSHKQHSVVPLEEVVQEYKAKLQGHVEPLRKHLEAVQKMKAKEERRVTELKSQMKSELAAVASEFGRLTRFLAEEQAGLERRLREMHEAQLGRAGAAASRLAEQAAQLSRLLAEAQERSQQGGLRLLQDIKETFNRCEEVQLQPPEVWSPDPCQPHSHDFLTDAIVRKMSRMFCQAARVDLTLDPDTAHPALMLSPDRRGVRLAERRQEVADHPKRFSADCCVLGAQGFRSGRHYWEEPKEPSWPPAQPSLTYYVCPTDRPEFSFT kpcd_mouse Protein kinase C delta type nPKC-delta Tyrosine-protein kinase PRKCD Prkcd Pkcd protein protein mouse Mus musculus Mouse MAPFLRISFNSYELGSLQVEDEASQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKTTFDAHIYEGRVIQIVLMRAAEDPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMCVQYFLEDGDCKQSMRSEEEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRSSRKLDTTESVGIYQGFEKKPEVSGSDILDNNGTYGKIWEGSTRCTLENFTFQKVLGKGSFGKVLLAELKGKDKYFAIKCLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTKDHLFFVMEFLNGGDLMFHIQDKGRFELYRATFYAAEIICGLQFLHSKGIIYRDLKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEKLFERDPDKRLGVTGNIRIHPFFKTINWSLLEKRKVEPPFKPKVKSPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQEAFHGFSFVNPKFEQFLDI kpcz_rat Protein kinase C zeta type Prkcz Pkcz nPKC-zeta protein protein rat Rattus norvegicus (Rat) Rat MPSRTDPKMDRSGGRVRLKAHYGGDILITSVDPTTTFQDLCEEVRDMCGLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLACQGRDEVLIIHVFPSIPEQPGMPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHVLVPLTCRRHMDSVMPSQEPPVDDKNDGVDLPSEETDGIAYISSSRKHDNIKDDSEDLKPVIDGVDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQTLPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSAEESV kpca_rat Protein kinase C alpha type Prkca Pkca protein protein rat Rattus norvegicus (Rat) Rat MADVYPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV tri41_human E3 ubiquitin-protein ligase TRIM41 TRIM41 RINCK Tripartite motif-containing protein 41 RING finger-interacting protein with C kinase RING-type E3 ubiquitin transferase TRIM41 protein protein human Homo sapiens Human MAAVAMTPNPVQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGGEDEEDRDELDREEEEEDGEEEEVEAVGAGAGWDTPMRDEDYEGDMEEEVEEEEEGVFWTSGMSRSSWDNMDYVWEEEDEEEDLDYYLGDMEEEDLRGEDEEDEEEVLEEVEEEDLDPVTPLPPPPAPRRCFTCPQCRKSFPRRSFRPNLQLANMVQVIRQMHPTPGRGSRVTDQGICPKHQEALKLFCEVDEEAICVVCRESRSHKQHSVVPLEEVVQEYKAKLQGHVEPLRKHLEAVQKMKAKEERRVTELKSQMKSELAAVASEFGRLTRFLAEEQAGLERRLREMHEAQLGRAGAAASRLAEQAAQLSRLLAEAQERSQQGGLRLLQDIKETFNRCEEVQLQPPEVWSPDPCQPHSHDFLTDAIVRKMSRMFCQAARVDLTLDPDTAHPALMLSPDRRGVRLAERRQEVADHPKRFSADCCVLGAQGFRSGRHYWEVEVGGRRGWAVGAARESTHHKEKVGPGGSSVGSGDASSSRHHHRRRRLHLPQQPLLQREVWCVGTNGKRYQAQSSTEQTLLSPSEKPRRFGVYLDYEAGRLGFYNAETLAHVHTFSAAFLGERVFPFFRVLSKGTRIKLCP kpca_human Protein kinase C alpha type PRKCA PKCA PRKACA protein protein human Homo sapiens Human MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV ubiq_yeast Ubiquitin UBI1 RPL40A YIL148W UBI2 RPL40B YKR094C UBI3 RPS31 YLR167W L9470.14 UBI4 SCD2 YLL039C protein protein yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG obsolete protein trim41-p68403 FLAG-RINCK1 coimmunoprecipitates PKC betaII from TsA201 lysates 677319 N/A 677326 unspecified role unspecified role prey prey N/A 677327 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3 A Q8WV44-2 transfection trim41-prkcd FLAG-RINCK1 coimmunoprecipitates PKC delta from TsA201 lysates 677319 N/A 677328 unspecified role unspecified role prey prey N/A 677327 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3 C Q8WV44-2 transfection trim41-pkc_zeta_rat FLAG-RINCK1 coimmunoprecipitates PKC zeta from TsA201 lysates 677319 N/A 677327 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 677329 unspecified role unspecified role prey prey physical association physical association false false false 3 B Q8WV44-2 transfection trim41-prkca FLAG-RINCK1 coimmunoprecipitates PKC alpha from TsA201 lysates 677320 N/A 677330 unspecified role unspecified role prey prey N/A 677327 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2 A Q8WV44-2; P05696 transfection trim41-p68403-1 FLAG-RINCK1 coimmunoprecipitates PKC betaII from TsA201 lysates 677320 N/A 677327 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 677326 unspecified role unspecified role prey prey physical association physical association false false false 3 D Q8WV44-2; P68403-2 transfection prkcb1-rinck1 PKC beta II interacts with RINCK1 in a yeast two-hybrid assay 677321 n/a 677331 unspecified role unspecified role prey prey N/A 677326 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false trim41-prkca-1 Endogenous RINCK1 coimmunoprecipitates endogenous PKC alpha from TsA201 lysates 677322 N/A 677327 unspecified role unspecified role bait bait N/A 677332 unspecified role unspecified role prey prey physical association physical association false false false 2 B trim41-prkca-2 GST-RINCK1 pulls down PKC alpha in vitro 677323 N/A 677330 unspecified role unspecified role prey prey N/A 677331 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 2 C p68403-trim41 GAT-PKC betaII (aa 1-111) pulls down FLAG-RINCK1 in TsA201 lysates 677324 N/A 677327 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 677326 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 4 ubi1-p68403 PKC betaII is ubiquitinated in TsA201 cells in the presence of exogenous RINCK 677325 N/A 677326 unspecified role unspecified role bait bait N/A 677333 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 6 RINCK1 - Overexpression of RINCK1 enhanced the ubiquitination of PKC betaII. The C20A mutation abolished this enhancement. P61864; P68403-2 transfection