IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ deng-2007-1 BH3 profiling identifies three distinct classes of apoptotic blocks to predict response to ABT-737 and conventional chemotherapeutic agents. human-sudhl-4 human sudhl-4 sudhl-4 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Deng J., Carlson N., Takeyama K., Dal Cin P., Shipp M., Letai A. Apoptosis - Interactions involving proteins with a function related to apoptosis anthony_letai@dfci.harvard.edu Cancer Cell (1535-6108) 2007 Only protein-protein interactions 2 imex curation Cancer - Interactions investigated in the context of cancer o43521-1 Bcl-2-like protein 11 Bim(EL) BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK o43521-2 Bcl-2-like protein 11 Bim(L) BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH bcl2-bim Bcl-2 coimmunoprecipitates Bim-EL in Su-DHL4 lysates 662079 N/A 662080 unspecified role unspecified role prey prey N/A 662081 unspecified role unspecified role bait bait physical association physical association false false false 2 F Three isoforms of BIM, BIM-EL, BIM-L and BIM-S, were coimmunoprecipitated with Bcl-2. The isoform BIM-S is not contained in the UniProtKB entry for this protein and so cannot be added as an interactor. bcl2-bim-1 Bcl-2 coimmunoprecipitates Bim-L in Su-DHL4 lysates 662079 N/A 662081 unspecified role unspecified role bait bait N/A 662082 unspecified role unspecified role prey prey physical association physical association false false false 2 F Three isoforms of BIM, BIM-EL, BIM-L and BIM-S, were coimmunoprecipitated with Bcl-2. The isoform BIM-S is not contained in the UniProtKB entry for this protein and so cannot be added as an interactor.