MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint maiuri-2007-2 Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1. in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Maiuri M.C., Le Toumelin G., Criollo A., Rain J.C., Gautier F., Juin P., Tasdemir E., Pierron G., Troulinaki K., Tavernarakis N., Hickman J.A., Geneste O., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions concerning Bcl2 and Mcl1 constructs (figures 2d and 2e), as well as those involving BAK peptides (supplementary figure 1)are not included due to lack of reference fo their origin in the text. Interactions depicted in figures 7a and 7b were not included due to lack of information about the cell line used in the experiment. olivier.geneste@fr.netgrs.com EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation maiuri-2007-1 Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Maiuri M.C., Le Toumelin G., Criollo A., Rain J.C., Gautier F., Juin P., Tasdemir E., Pierron G., Troulinaki K., Tavernarakis N., Hickman J.A., Geneste O., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions concerning Bcl2 and Mcl1 constructs (figures 2d and 2e), as well as those involving BAK peptides (supplementary figure 1)are not included due to lack of reference fo their origin in the text. Interactions depicted in figures 7a and 7b were not included due to lack of information about the cell line used in the experiment. olivier.geneste@fr.netgrs.com EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation maiuri-2007-3 Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Maiuri M.C., Le Toumelin G., Criollo A., Rain J.C., Gautier F., Juin P., Tasdemir E., Pierron G., Troulinaki K., Tavernarakis N., Hickman J.A., Geneste O., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions concerning Bcl2 and Mcl1 constructs (figures 2d and 2e), as well as those involving BAK peptides (supplementary figure 1)are not included due to lack of reference fo their origin in the text. Interactions depicted in figures 7a and 7b were not included due to lack of information about the cell line used in the experiment. olivier.geneste@fr.netgrs.com EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation maiuri-2007-4 Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Maiuri M.C., Le Toumelin G., Criollo A., Rain J.C., Gautier F., Juin P., Tasdemir E., Pierron G., Troulinaki K., Tavernarakis N., Hickman J.A., Geneste O., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions concerning Bcl2 and Mcl1 constructs (figures 2d and 2e), as well as those involving BAK peptides (supplementary figure 1)are not included due to lack of reference fo their origin in the text. Interactions depicted in figures 7a and 7b were not included due to lack of information about the cell line used in the experiment. olivier.geneste@fr.netgrs.com EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation maiuri-2007-5 Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1. human-mv4-11 Human MV4-11, Acute Monocytic Leukemia cell line mv4-11 MV4-11 a human MLL leukemia cell line https://www.lgcstandards-atcc.org/Products/All/CRL-9591.aspx Human acute monocytic leukemia cell line. Described to carry a 4;11 translocation; MV4-11 carries an FLT3 internal tandem duplication. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Maiuri M.C., Le Toumelin G., Criollo A., Rain J.C., Gautier F., Juin P., Tasdemir E., Pierron G., Troulinaki K., Tavernarakis N., Hickman J.A., Geneste O., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions concerning Bcl2 and Mcl1 constructs (figures 2d and 2e), as well as those involving BAK peptides (supplementary figure 1)are not included due to lack of reference fo their origin in the text. Interactions depicted in figures 7a and 7b were not included due to lack of information about the cell line used in the experiment. olivier.geneste@fr.netgrs.com EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK bad_human Bcl2-associated agonist of cell death Bcl-2-binding component 6 Bcl-2-like protein 8 BAD BBC6 BCL2L8 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein human Homo sapiens Human MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ bcl2l1-bak1 653948 n/a 653953 competitor competitor competitor neutral component neutral component purified purified Q14457:p.Leu116Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q14457:p.Phe123Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false bh3 domain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 653954 unspecified role unspecified role neutral component neutral component purified purified fluorescein tag fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false bh3 domain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 653955 unspecified role unspecified role neutral component neutral component purified purified bcl-xl delta-tm sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 653948 1c bak1-bcl2l1-3 653948 n/a 653954 competitor competitor competitor neutral component neutral component purified purified bh3 domain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 653955 unspecified role unspecified role neutral component neutral component purified purified bcl-xl delta-tm sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 653954 unspecified role unspecified role neutral component neutral component purified purified fluorescein tag fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false bh3 domain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 653948 1c bak1-bcl2l1-4 653948 n/a 653953 competitor competitor competitor neutral component neutral component purified purified fluorescein tag fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bh3 domain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 653955 unspecified role unspecified role neutral component neutral component purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false bcl-xl delta-tm sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q07817-1:p.Gly138Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 653948 653948 1d and 2a BH3 domain mimetic compound ABT737 disrupts the interaction in a dose-dependent manner. bcl2l1-becn1 653949 n/a 653955 unspecified role unspecified role bait bait bcl-xl delta-tm sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 653953 unspecified role unspecified role prey prey binding region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false 653990 653988 physical association physical association false false false 1a bcl2-becn1 653949 n/a 653953 unspecified role unspecified role prey prey binding region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 653956 unspecified role unspecified role bait bait bcl2 delta-tm sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 653995 653993 physical association physical association false false false 1a bcl2l1-becn1-1 653950 n/a 653955 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 653953 unspecified role unspecified role prey prey Q14457:p.Phe123Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false v5-his tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q14457:p.Leu116Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1e and 2b BH3 domain mimetic compound ABT737 disrupts the interaction in a dose-dependent manner. bcl2l1-becn1-2 653950 n/a 653955 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q07817-1:p.Gly138Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 653953 unspecified role unspecified role prey prey physical association physical association false false false 1f and 2c BH3 domain mimetic compound ABT737 disrupts the interaction in a dose-dependent manner. bcl2-becn1-1 653951 n/a 653953 unspecified role unspecified role prey prey n/a 653956 unspecified role unspecified role bait bait physical association physical association false false false 6a, 7G BH3 domain mimetic compound ABT737 and starvation conditions disrupt the interaction. bcl2-bad-2 653951 n/a 653956 unspecified role unspecified role bait bait n/a 653957 unspecified role unspecified role prey prey physical association physical association false false false 7c BH3 domain mimetic compound ABT737 and starvation conditions disrupt the interaction. bcl2-becn1-2 653952 n/a 653953 unspecified role unspecified role prey prey n/a 653956 unspecified role unspecified role bait bait physical association physical association false false false 6a BH3 domain mimetic compound ABT737 and starvation conditions disrupt the interaction.