IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bruey-2007-5 Bcl-2 and Bcl-XL regulate proinflammatory caspase-1 activation by interaction with NALP1. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bruey JM., Bruey-Sedano N., Luciano F., Zhai D., Balpai R., Xu C., Kress CL., Bailly-Maitre B., Li X., Osterman A., Matsuzawa S., Terskikh AV., Faustin B., Reed JC. Apoptosis - Interactions involving proteins with a function related to apoptosis The range of the Bcl-2 Delta loop deletion was found in Fang et al. 1998 Cancer Research 58 3202-3208 reedoffice@burnham.org Cell (0092-8674) 2007 Only protein-protein interactions 24 imex curation Cancer - Interactions investigated in the context of cancer bruey-2007-4 Bcl-2 and Bcl-XL regulate proinflammatory caspase-1 activation by interaction with NALP1. human-thp-1 Homo sapiens acute monocytic leukemia cells thp-1 Human acute monocytic leukemia cell line Human acute monocytic leukemia established from the peripheral blood of a 1-year-old boy with acute monocytic leukemia (AML) at relapse in 1978. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bruey JM., Bruey-Sedano N., Luciano F., Zhai D., Balpai R., Xu C., Kress CL., Bailly-Maitre B., Li X., Osterman A., Matsuzawa S., Terskikh AV., Faustin B., Reed JC. Apoptosis - Interactions involving proteins with a function related to apoptosis reedoffice@burnham.org Cell (0092-8674) 2007 Only protein-protein interactions 24 imex curation Cancer - Interactions investigated in the context of cancer bruey-2007-1 Bcl-2 and Bcl-XL regulate proinflammatory caspase-1 activation by interaction with NALP1. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bruey JM., Bruey-Sedano N., Luciano F., Zhai D., Balpai R., Xu C., Kress CL., Bailly-Maitre B., Li X., Osterman A., Matsuzawa S., Terskikh AV., Faustin B., Reed JC. Apoptosis - Interactions involving proteins with a function related to apoptosis reedoffice@burnham.org Cell (0092-8674) 2007 Only protein-protein interactions 24 imex curation Cancer - Interactions investigated in the context of cancer bruey-2007-2 Bcl-2 and Bcl-XL regulate proinflammatory caspase-1 activation by interaction with NALP1. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Bruey JM., Bruey-Sedano N., Luciano F., Zhai D., Balpai R., Xu C., Kress CL., Bailly-Maitre B., Li X., Osterman A., Matsuzawa S., Terskikh AV., Faustin B., Reed JC. Apoptosis - Interactions involving proteins with a function related to apoptosis reedoffice@burnham.org Cell (0092-8674) 2007 Only protein-protein interactions 24 imex curation Cancer - Interactions investigated in the context of cancer bruey-2007-3 Bcl-2 and Bcl-XL regulate proinflammatory caspase-1 activation by interaction with NALP1. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bruey JM., Bruey-Sedano N., Luciano F., Zhai D., Balpai R., Xu C., Kress CL., Bailly-Maitre B., Li X., Osterman A., Matsuzawa S., Terskikh AV., Faustin B., Reed JC. Apoptosis - Interactions involving proteins with a function related to apoptosis reedoffice@burnham.org Cell (0092-8674) 2007 Only protein-protein interactions 24 imex curation Cancer - Interactions investigated in the context of cancer bruey-2007-6 Bcl-2 and Bcl-XL regulate proinflammatory caspase-1 activation by interaction with NALP1. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy antibody detection identification by antibody antibody detection Bruey JM., Bruey-Sedano N., Luciano F., Zhai D., Balpai R., Xu C., Kress CL., Bailly-Maitre B., Li X., Osterman A., Matsuzawa S., Terskikh AV., Faustin B., Reed JC. Apoptosis - Interactions involving proteins with a function related to apoptosis reedoffice@burnham.org Cell (0092-8674) 2007 Only protein-protein interactions 24 imex curation Cancer - Interactions investigated in the context of cancer nlrp1_human NACHT, LRR and PYD domains-containing protein 1 NLRP1 CARD7 DEFCAP KIAA0926 NAC NALP1 Death effector filament-forming ced-4-like apoptosis protein Nucleotide-binding domain and caspase recruitment domain Caspase recruitment domain-containing protein 7 protein protein human Homo sapiens Human MAGGAWGRLACYLEFLKKEELKEFQLLLANKAHSRSSSGETPAQPEKTSGMEVASYLVAQYGEQRAWDLALHTWEQMGLRSLCAQAQEGAGHSPSFPYSPSEPHLGSPSQPTSTAVLMPWIHELPAGCTQGSERRVLRQLPDTSGRRWREISASLLYQALPSSPDHESPSQESPNAPTSTAVLGSWGSPPQPSLAPREQEAPGTQWPLDETSGIYYTEIREREREKSEKGRPPWAAVVGTPPQAHTSLQPHHHPWEPSVRESLCSTWPWKNEDFNQKFTQLLLLQRPHPRSQDPLVKRSWPDYVEENRGHLIEIRDLFGPGLDTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCRELAQSKVVSLAELIGKDGTATPAPIRQILSRPERLLFILDGVDEPGWVLQEPSSELCLHWSQPQPADALLGSLLGKTILPEASFLITARTTALQNLIPSLEQARWVEVLGFSESSRKEYFYRYFTDERQAIRAFRLVKSNKELWALCLVPWVSWLACTCLMQQMKRKEKLTLTSKTTTTLCLHYLAQALQAQPLGPQLRDLCSLAAEGIWQKKTLFSPDDLRKHGLDGAIISTFLKMGILQEHPIPLSYSFIHLCFQEFFAAMSYVLEDEKGRGKHSNCIIDLEKTLEAYGIHGLFGASTTRFLLGLLSDEGEREMENIFHCRLSQGRNLMQWVPSLQLLLQPHSLESLHCLYETRNKTFLTQVMAHFEEMGMCVETDMELLVCTFCIKFSRHVKKLQLIEGRQHRSTWSPTMVVLFRWVPVTDAYWQILFSVLKVTRNLKELDLSGNSLSHSAVKSLCKTLRRPRCLLETLRLAGCGLTAEDCKDLAFGLRANQTLTELDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQLVSCGLTSDCCQDLASVLSASPSLKELDLQQNNLDDVGVRLLCEGLRHPACKLIRLGLDQTTLSDEMRQELRALEQEKPQLLIFSRRKPSVMTPTEGLDTGEMSNSTSSLKRQRLGSERAASHVAQANLKLLDVSKIFPIAEIAEESSPEVVPVELLCVPSPASQGDLHTKPLGTDDDFWGPTGPVATEVVDKEKNLYRVHFPVAGSYRWPNTGLCFVMREAVTVEIEFCVWDQFLGEINPQHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQMAHFKEEGMLLEKPARVELHHIVLENPSFSPLGVLLKMIHNALRFIPVTSVVLLYHRVHPEEVTFHLYLIPSDCSIRKAIDDLEMKFQFVRIHKPPPLTPLYMGCRYTVSGSGSGMLEILPKELELCYRSPGEDQLFSEFYVGHLGSGIRLQVKDKKDETLVWEALVKPGDLMPATTLIPPARIAVPSPLDAPQLLHFVDQYREQLIARVTSVEVVLDKLHGQVLSQEQYERVLAENTRPSQMRKLFSLSQSWDRKCKDGLYQALKETHPHLIMELWEKGSKKGLLPLSS casp1_human Caspase-1 Interleukin-1 beta convertase Interleukin-1 beta-converting enzyme p45 CASP1 IL1BC IL1BCE protein protein human Homo sapiens Human MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH casp5_human Caspase-5 CASP5 ICH3 Protease ICH-3 Protease TY ICE(rel)-III protein protein human Homo sapiens Human MAEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVKKDNHKKKTVKMLEYLGKDVLHGVFNYLAKHDVLTLKEEEKKKYYDTKIEDKALILVDSLRKNRVAHQMFTQTLLNMDQKITSVKPLLQIEAGPPESAESTNILKLCPREEFLRLCKKNHDEIYPIKKREDRRRLALIICNTKFDHLPARNGAHYDIVGMKRLLQGLGYTVVDEKNLTARDMESVLRAFAARPEHKSSDSTFLVLMSHGILEGICGTAHKKKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCKIHEEKDFIAFCSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLMEIFRKVQKSFEVPQAKAQMPTIERATLTRDFYLFPGN nlrc4_human NLR family CARD domain-containing protein 4 NLRC4 CLAN CLAN1 UNQ6189/PRO20215 CARD12 IPAF Caspase recruitment domain-containing protein 12 Ice protease-activating factor CARD, LRR, and NACHT-containing protein protein protein human Homo sapiens Human MNFIKDNSRALIQRMGMTVIKQITDDLFVWNVLNREEVNIICCEKVEQDAARGIIHMILKKGSESCNLFLKSLKEWNYPLFQDLNGQSLFHQTSEGDLDDLAQDLKDLYHTPSFLNFYPLGEDIDIIFNLKSTFTEPVLWRKDQHHHRVEQLTLNGLLQALQSPCIIEGESGKGKSTLLQRIAMLWGSGKCKALTKFKFVFFLRLSRAQGGLFETLCDQLLDIPGTIRKQTFMAMLLKLRQRVLFLLDGYNEFKPQNCPEIEALIKENHRFKNMVIVTTTTECLRHIRQFGALTAEVGDMTEDSAQALIREVLIKELAEGLLLQIQKSRCLRNLMKTPLFVVITCAIQMGESEFHSHTQTTLFHTFYDLLIQKNKHKHKGVAASDFIRSLDHCGDLALEGVFSHKFDFELQDVSSVNEDVLLTTGLLCKYTAQRFKPKYKFFHKSFQEYTAGRRLSSLLTSHEPEEVTKGNGYLQKMVSISDITSTYSSLLRYTCGSSVEATRAVMKHLAAVYQHGCLLGLSIAKRPLWRQESLQSVKNTTEQEILKAININSFVECGIHLYQESTSKSALSQEFEAFFQGKSLYINSGNIPDYLFDFFEHLPNCASALDFIKLDFYGGAMASWEKAAEDTGGIHMEEAPETYIPSRAVSLFFNWKQEFRTLEVTLRDFSKLNKQDIRYLGKIFSSATSLRLQIKRCAGVAGSLSLVLSTCKNIYSLMVEASPLTIEDERHITSVTNLKTLSIHDLQNQRLPGGLTDSLGNLKNLTKLIMDNIKMNEEDAIKLAEGLKNLKKMCLFHLTHLSDIGEGMDYIVKSLSSEPCDLEEIQLVSCCLSANAVKILAQNLHNLVKLSILDLSENYLEKDGNEALHELIDRMNVLEQLTALMLPWGCDVQGSLSSLLKHLEEVPQLVKLGLKNWRLTDTEIRILGAFFGKNPLKNFQQLNLAGNRVSSDGWLAFMGVFENLKQLVFFDFSTKEFLPDPALVRKLSQVLSKLTFLQEARLVGWQFDDDDLSVITGAFKLVTA asc_human Apoptosis-associated speck-like protein containing a CARD PYD and CARD domain-containing protein Target of methylation-induced silencing 1 Caspase recruitment domain-containing protein 5 ASC CARD5 TMS1 PYCARD protein protein human Homo sapiens Human MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS b2cl1_human Bcl-2-like protein 1 BCL2L1 BCL2L BCLX Apoptosis regulator Bcl-X protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK casp1-nalp1 FLAG-pro-caspase-1 coimmunoprecipitates Myc-NALP1 in HEK283T lysate 605859 N/A 605865 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605866 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S2 P29466; Q9C000 transfection casp5-nalp1 FLAG-pro-caspase-5 coimmunoprecipitates Myc-NALP1 in HEK283T lysate 605859 N/A 605867 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605865 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S2 Q9C000; P51878 transfection casp1-card12 FLAG-pro-caspase-1 coimmunoprecipitates Myc-CLAN in HEK283T lysate 605859 N/A 605866 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605868 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S2 Q9NPP4; P29466 transfection nalp1-pycard-1 Myc-NALP1 coimmunoprecipitated GFP-ASC in 293T extracts 605859 N/A 605869 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605870 inhibitor inhibitor unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605865 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 3 C Q9ULZ3; Q9C000; Q07817 transfection The interaction did not occur in the presence of MDP-DD. The presence of GST-Bl-xL inhibited the interaction. nalp1-pycard-2 Myc-NALP1 coimmunoprecipitated GFP-ASC in 293T extracts 605859 N/A 605871 inhibitor inhibitor unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605869 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605865 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 3 D Q9ULZ3; Q9C000; P10415 transfection The interaction did not occur in the presence of MDP-DD. The presence of Bcl-2-GST inhibited the interaction. The presence of Bcl-B-GST did not inhibit the interaction. bcl2-nalp1-5 Myc-Bcl-2 coimmunoprecipitates FLAG-NALP1 in HEK-293T lysates 605859 N/A 605865 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605871 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 4 A Q9C000; P10415 transfection bcl2l2l1-nalp1-1 Myc-Bcl-xL coimmunoprecipitates FLAG-NALP1 in HEK-293T lysates 605859 N/A 605870 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 605865 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4 A Q9C000; Q07817 transfection bcl2l2l1-nalp1-2 FLAG-Bcl-xL coimmunoprecipitates Myc-NALP1 in HEK-293T lysates 605859 N/A 605865 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605870 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false S7B Q9C000; Q07817 transfection bcl2l2l1-nalp1-3 HA-Bcl-xL coimmunoprecipitates FLAG-NALP1 in HEK-293T lysates 605859 N/A 605870 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605865 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 4 D Q9C000; Q07817 transfection nalp1-pycard NALP1 coimmunoprecipitates ASC in lysates from THP-1 cells cultured with MDP/ATP 605860 N/A 605865 unspecified role unspecified role bait bait N/A 605869 unspecified role unspecified role prey prey N/A 605871 inhibitor inhibitor prey prey association association false false false 2 B, 5 F This interaction occurred when cells were cultured with MDP/ATP, MDP-LD or LPS. P10415 infection nalp1-bcl2 NALP1 coimmunoprecipitates Bcl-2 and Bcl-xL in lysates from THP-1 cells 605860 N/A 605871 unspecified role unspecified role prey prey N/A 605870 unspecified role unspecified role prey prey N/A 605865 unspecified role unspecified role bait bait association association false false false 2 B This interaction did not occur when cells were cultured with MDP/ATP. bcl2-nalp1-4 NALP1 coimmunoprecipitates with Bcl-2 in lysates from THP-1 cells 605860 N/A 605865 unspecified role unspecified role prey prey N/A 605871 unspecified role unspecified role bait bait physical association physical association false false false 2 C This interaction does not occur in LPS/ATP treated cells. pycard-nalp1 NALP1 coimmunoprecipitates with ASC in lysates from THP-1 cells treated with LPS/ATP 605860 N/A 605869 unspecified role unspecified role bait bait N/A 605865 unspecified role unspecified role prey prey physical association physical association false false false 2 D This interaction occurs in cells treated with LPS/ATP. nalp1-bcl2-2 NALP1 coimmunoprecipitates ASC and Bcl-2 in lysates from THP-1 cells treated with LPS/ATP 605860 N/A 605869 unspecified role unspecified role prey prey N/A 605865 unspecified role unspecified role bait bait N/A 605871 unspecified role unspecified role prey prey association association false false false S1 These interactions occur in cells treated with LPS/ATP. nalp1-bcl2-1 NALP1 coimmunoprecipitates Bcl-2 in lysates from THP-1 cells 605860 N/A 605871 unspecified role unspecified role prey prey N/A 605865 unspecified role unspecified role bait bait physical association physical association false false false S1 bcl2-nalp1 Myc-Bcl-2 coimmunoprecipitates FLAG-NALP1 in HEK-293T lysates 605861 N/A 605871 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605865 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 A Q9C000; P10415 transfection bcl2l1-nalp1 Myc-Bcl-xL coimmunoprecipitates FLAG-NALP1 in HEK-293T lysates 605861 N/A 605865 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605870 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 A Q9C000; Q07817 transfection nalp1-bcl2l1 Myc-Bcl-xL coimmunoprecipitates with FLAG-NALP1 in HEK-293T lysates 605861 N/A 605870 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605865 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 B Q9C000; Q07817 transfection bcl2-nalp1-1 GST-Bcl2 pulls down NALP1 in vitro from 293T cell extract overexpressing NALP1 605862 N/A 605865 unspecified role unspecified role prey prey N/A 605871 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 C bcl2l2l1-nalp1 GST-Bcl-xL pulls down NALP1 in vitro from 293T cell extract overexpressing NALP1 605862 N/A 605865 unspecified role unspecified role prey prey N/A 605870 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 C bcl2l1l2-nalp1 FLAG-Bcl-xL coimmunoprecipitates NALP1-Myc in 293T lysates 605863 N/A 605870 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605865 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 D Q9C000; Q07817 transfection bcl2-nalp1-2 FLAG-Bcl-2 coimmunoprecipitates NALP1-Myc in 293T lysates 605863 N/A 605865 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605871 unspecified role unspecified role bait bait physical association physical association false false false 1 E Q9C000; Q07817 transfection bcl2-nalp1-6 FLAG-NALP1 and Myc-Bcl-2 colocalize in HeLa cells 605864 N/A 605871 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 605865 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false S8 bcl2-nalp1-7 FLAG-NALP1 and Myc-Bcl-2 colocalize in HeLa cells 605864 N/A 605871 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 605865 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false S8