IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lin-2007-1 Involvement of maternal embryonic leucine zipper kinase (MELK) in mammary carcinogenesis through interaction with Bcl-G, a pro-apoptotic member of the Bcl-2 family. in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Lin ML., Park JH., Nishidate T., Nakamura Y., Katagiri T. Apoptosis - Interactions involving proteins with a function related to apoptosis yusuke@ims.u-tokyo.ac.jp Breast Cancer Res. (1465-5411) 2007 Cancer - Interactions investigated in the context of cancer lin-2007-2 Involvement of maternal embryonic leucine zipper kinase (MELK) in mammary carcinogenesis through interaction with Bcl-G, a pro-apoptotic member of the Bcl-2 family. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lin ML., Park JH., Nishidate T., Nakamura Y., Katagiri T. Apoptosis - Interactions involving proteins with a function related to apoptosis yusuke@ims.u-tokyo.ac.jp Breast Cancer Res. (1465-5411) 2007 Cancer - Interactions investigated in the context of cancer lin-2007-3 Involvement of maternal embryonic leucine zipper kinase (MELK) in mammary carcinogenesis through interaction with Bcl-G, a pro-apoptotic member of the Bcl-2 family. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Lin ML., Park JH., Nishidate T., Nakamura Y., Katagiri T. Apoptosis - Interactions involving proteins with a function related to apoptosis yusuke@ims.u-tokyo.ac.jp Breast Cancer Res. (1465-5411) 2007 Cancer - Interactions investigated in the context of cancer b2l14_human Apoptosis facilitator Bcl-2-like protein 14 Apoptosis regulator Bcl-G BCL2L14 BCLG protein protein human Homo sapiens Human MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD melk_human Maternal embryonic leucine zipper kinase Protein kinase PK38 MELK KIAA0175 Protein kinase Eg3 Tyrosine-protein kinase MELK protein protein human Homo sapiens Human MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV melk-bcl2l14 MELK pulls down Bcl-G from HBC4 lysates 662190 N/A 662193 unspecified role unspecified role prey prey human-hbc4 Homo sapiens breast cancer cell line HBC4 hbc4 Human breast cancer cell line HBC4 N/A 662194 unspecified role unspecified role bait bait Q14680:p.Asp150Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 3 A BAIT gene NM_014791 melk-bcl2l14-2 His-MELK pulls down Bcl-G in vitro 662190 N/A 662193 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) N/A 662194 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q14680:p.Asp150Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 3 D melk-bcl2l14-1 FLAG-Bcl-G coimmunoprecipitates HA-MELK in HeLa lysates 662191 N/A 662194 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 662193 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3 C, E, F Q14680; Q9BZR8 transfection melk-bcl2l14-3 MELK phosphorylates GST-Bcl-GL in vitro 662192 N/A 662194 enzyme enzyme bait bait Q14680:p.Asp150Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 662193 enzyme target enzyme target substrate substrate prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false phosphorylation phosphorylation reaction phosphorylation false false false 4 B, C