IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ konopleva-2006-1 Mechanisms of apoptosis sensitivity and resistance to the BH3 mimetic ABT-737 in acute myeloid leukemia. human-oci_aml3 Homo sapiens OCI-AML3 oci_aml3 OCI-AML3 Established from the peripheral blood of a 57-year-old man with acute myeloid leukemia; cells carry an NPM gene mutation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Konopleva M., Contractor R., Tsao T., Samudio I., Ruvolo PP., Kitada S., Deng X., Zhai D., Shi YX., Sneed T., Verhaegen M., Soengas M., Ruvolo VR., McQueen T., Schober WD., Watt JC., Jiffar T., Ling X., Marini FC., Harris D., Dietrich M., Estrov Z., McCubrey J., May WS., Reed JC., Andreeff M. Apoptosis - Interactions involving proteins with a function related to apoptosis mandreef@mdanderson.org Cancer Cell (1535-6108) 2006 Only protein-protein interactions 1 imex curation Cancer - Interactions investigated in the context of cancer mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS bak1-mcl1 570697 N/A 570698 unspecified role unspecified role prey prey N/A 570699 unspecified role unspecified role bait bait physical association physical association false false false 4 B ABT-737 treatment did not affect the amount of MCcl-1 coiimunoprecipitated with Bak. In ABT-737-sensitive HL-60 cells, no detectable MCL-1 was found in complex with Bak.