IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ li-2006d-2 Human cellular protein VRK2 interacts specifically with Epstein-Barr virus BHRF1, a homologue of Bcl-2, and enhances cell survival. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li LY., Liu MY., Shih HM., Tsai CH., Chen JY. Apoptosis - Interactions involving proteins with a function related to apoptosis myliu@mail1.ntcn.edu.tw,cjy@nhri.org.tw J. Gen. Virol. (0022-1317) 2006 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer A cDNA library from human normal foreskin keratinocytes was used. li-2006d-5 Human cellular protein VRK2 interacts specifically with Epstein-Barr virus BHRF1, a homologue of Bcl-2, and enhances cell survival. human-rhek_1 Homo sapiens keratinocyte cell line RHEK-1 rhek_1 human keratinocyte cell line RHEK-1 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Li LY., Liu MY., Shih HM., Tsai CH., Chen JY. Apoptosis - Interactions involving proteins with a function related to apoptosis myliu@mail1.ntcn.edu.tw,cjy@nhri.org.tw J. Gen. Virol. (0022-1317) 2006 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer A cDNA library from human normal foreskin keratinocytes was used. li-2006d-1 Human cellular protein VRK2 interacts specifically with Epstein-Barr virus BHRF1, a homologue of Bcl-2, and enhances cell survival. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Li LY., Liu MY., Shih HM., Tsai CH., Chen JY. Apoptosis - Interactions involving proteins with a function related to apoptosis myliu@mail1.ntcn.edu.tw,cjy@nhri.org.tw A cDNA library from human normal foreskin keratinocytes was used. J. Gen. Virol. (0022-1317) 2006 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer li-2006d-3 Human cellular protein VRK2 interacts specifically with Epstein-Barr virus BHRF1, a homologue of Bcl-2, and enhances cell survival. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Li LY., Liu MY., Shih HM., Tsai CH., Chen JY. Apoptosis - Interactions involving proteins with a function related to apoptosis myliu@mail1.ntcn.edu.tw,cjy@nhri.org.tw J. Gen. Virol. (0022-1317) 2006 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer A cDNA library from human normal foreskin keratinocytes was used. li-2006d-4 Human cellular protein VRK2 interacts specifically with Epstein-Barr virus BHRF1, a homologue of Bcl-2, and enhances cell survival. human-rhek_1 Homo sapiens keratinocyte cell line RHEK-1 rhek_1 human keratinocyte cell line RHEK-1 confocal microscopy confocal microscopy antibody detection identification by antibody antibody detection Li LY., Liu MY., Shih HM., Tsai CH., Chen JY. Apoptosis - Interactions involving proteins with a function related to apoptosis The cells used were a stably-transfected RHEK-1 cell line, NR27-2, characterized by doxycycline inducible BHFR1 expression. myliu@mail1.ntcn.edu.tw,cjy@nhri.org.tw J. Gen. Virol. (0022-1317) 2006 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer A cDNA library from human normal foreskin keratinocytes was used. vrk2_human Serine/threonine-protein kinase VRK2 VRK2 Vaccinia-related kinase 2 protein protein human Homo sapiens Human MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVNKAHNRLIEKKVHSERSAESCATWKVQKEEKLIGLMNNEAAQESTRRRQKYQESQEPLNEVNSFPQKISYTQFPNSFYEPHQDFTSPDIFKKSRSPSWYKYTSTVSTGITDLESSTGLWPTISQFTLSEETNADVYYYRIIIPVLLMLVFLALFFL ear_ebvb9 Apoptosis regulator BHRF1 BHRF1 Nuclear antigen Early antigen protein R protein protein ebvb9 Epstein-Barr virus (strain B95-8) (HHV-4) Human herpesvirus 4 HHV-4 MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISRGRH bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK bhfr1-vrk2-1 BHFR1 interacts with VRK2 in a yeast two-hybrid assay 595369 N/A 595374 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 595375 unspecified role unspecified role bait bait physical association physical association false false false 1 C, 5 B, C, D The protein P03182 relates to BHRF1 from EBV strain B95-8, but the authors in the paper Li et al., 2001 referred to do not specify the strain of EBV. This is the only UniProtKb entry corresponding to BHFR1. The length of the protein used and P03182 are the same. The deletion analysis suggested the last 108 C-terminal residues of VRK2 are important for the interaction. However, as VRK2-(94-508) did not interact with BHRF1, it may be that the first 93 aa contribute to a conformation required for interaction, or there may be an inhibitory domain in aa 94-174. bhfr1-vrk2-6 BHFR1 interacts with VRK2 in a yeast two-hybrid assay 595369 N/A 595374 unspecified role unspecified role prey prey N/A 595375 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1 C, 5 F, G, H The protein P03182 relates to BHRF1 from EBV strain B95-8, but the authors in the paper Li et al., 2001 referred to do not specify the strain of EBV. This is the only UniProtKb entry corresponding to BHFR1. The length of the protein used and P03182 are the same. Deletion analysis suggests the first 18 aa (including BH4 domain) and aa 89-142 (including BH1 domain) of BHRF1 are important for binding VRK2. bcl2-vrk2 Bcl-2 interacts weakly with VRK2 in a yeast two-hybrid assay 595369 N/A 595376 unspecified role unspecified role bait bait N/A 595374 unspecified role unspecified role prey prey physical association physical association false false false 1 C, 5 F, G, H There was a positive reaction after 8 h. Thus the authors term this weaker than the interaction with BHFR1 which occurs within 30 min. vrk2-bhfr1 BHFR1 coimmunoprecipitates with HA-VRK2 in NR27-2 (RHEK-1) cell lysates 595370 N/A 595374 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 595375 unspecified role unspecified role prey prey physical association physical association false false false 4 B The protein P03182 relates to BHRF1 from EBV strain B95-8, but the authors in the paper Li et al., 2001 referred to do not specify the strain of EBV. This is the only UniProtKb entry corresponding to BHFR1. The length of the protein used and P03182 are the same. Q86Y07; P03182 transfection bhfr1-vrk2-5 BHFR1 coimmunoprecipitates HA-VRK2 in NR27-2 (RHEK-1) cell lysates 595370 N/A 595374 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 595375 unspecified role unspecified role bait bait physical association physical association false false false 4 B The protein P03182 relates to BHRF1 from EBV strain B95-8, but the authors in the paper Li et al., 2001 referred to do not specify the strain of EBV. This is the only UniProtKb entry corresponding to BHFR1. The length of the protein used and P03182 are the same. Q86Y07; P03182 transfection This interaction is shown in 4 B, although in the text there is a note that data is not shown. bhfr1-vrk2 BHFR1 interacts with VRK2 in a yeast two-hybrid screen 595371 N/A 595374 unspecified role unspecified role prey prey N/A 595375 unspecified role unspecified role bait bait physical association physical association false false false The protein P03182 relates to BHRF1 from EBV strain B95-8, but the authors in the paper Li et al., 2001 referred to do not specify the strain of EBV. This is the only UniProtKb entry corresponding to BHFR1. The length of the protein used and P03182 are the same. bhfr1-vrk2-2 GST-BHFR1 pulls down HA-VRK2 in vitro 595372 N/A 595375 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 595374 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2 C The protein P03182 relates to BHRF1 from EBV strain B95-8, but the authors in the paper Li et al., 2001 referred to do not specify the strain of EBV. This is the only UniProtKb entry corresponding to BHFR1. The length of the protein used and P03182 are the same. bhfr1-vrk2-3 BHFR1 colocalizes with HA-VRK2 in NR27-2 (RHEK-1) cells 595373 N/A 595375 unspecified role unspecified role neutral component neutral component N/A 595374 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 3 The protein P03182 relates to BHRF1 from EBV strain B95-8, but the authors in the paper Li et al., 2001 referred to do not specify the strain of EBV. This is the only UniProtKb entry corresponding to BHFR1. The length of the protein used and P03182 are the same. Q86Y07; P03182 transfection