IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ certo-2006-1 Mitochondria primed by death signals determine cellular addiction to antiapoptotic BCL-2 family members. in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Certo M., Del Gaizo Moore V., Nishino M., Wei G., Korsmeyer S., Armstrong SA., Letai A. Apoptosis - Interactions involving proteins with a function related to apoptosis anthony_letai@dfci.harvard.edu Cancer Cell (1535-6108) 2006 Only protein-protein interactions 30 imex curation Cancer - Interactions investigated in the context of cancer certo-2006-2 Mitochondria primed by death signals determine cellular addiction to antiapoptotic BCL-2 family members. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Certo M., Del Gaizo Moore V., Nishino M., Wei G., Korsmeyer S., Armstrong SA., Letai A. Apoptosis - Interactions involving proteins with a function related to apoptosis anthony_letai@dfci.harvard.edu Cancer Cell (1535-6108) 2006 Only protein-protein interactions 30 imex curation Cancer - Interactions investigated in the context of cancer bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK bid_human BH3-interacting domain death agonist p22 BID BID protein protein human Homo sapiens Human MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD bad_mouse Bcl2-associated agonist of cell death Bad Bbc6 Bcl-2-binding component 6 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein mouse Mus musculus Mouse MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH bik_human Bcl-2-interacting killer Apoptosis inducer NBK BP4 BIP1 BIK NBK protein protein human Homo sapiens Human MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK bbc3_human Bcl-2-binding component 3, isoforms 1/2 p53 up-regulated modulator of apoptosis JFY-1 BBC3 PUMA protein protein human Homo sapiens Human MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN bmf_mouse Bcl-2-modifying factor Bmf protein protein mouse Mus musculus Mouse MEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQQNRDRAWWQVFLFLQNLALNRQENREGVGPW b2cl2_human Bcl-2-like protein 2 Apoptosis regulator Bcl-W BCL2L2 BCLW KIAA0271 protein protein human Homo sapiens Human MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK b2cl1_human Bcl-2-like protein 1 BCL2L1 BCL2L BCLX Apoptosis regulator Bcl-X protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK hrk_human Activator of apoptosis harakiri Neuronal death protein DP5 BH3-interacting domain-containing protein 3 HRK BID3 protein protein human Homo sapiens Human MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR apr_mouse Phorbol-12-myristate-13-acetate-induced protein 1 Pmaip1 Noxa Protein Noxa protein protein mouse Mus musculus Mouse MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT b2la1_human Bcl-2-related protein A1 Protein BFL-1 Hemopoietic-specific early response protein Protein GRS BCL2A1 BCL2L5 BFL1 GRS HBPA1 Bcl-2-like protein 5 protein protein human Homo sapiens Human MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC bid_mouse BH3-interacting domain death agonist p22 BID Bid protein protein mouse Mus musculus Mouse MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD bcl2-bid 508001 N/A 508003 unspecified role unspecified role neutral component neutral component n-terminal protein with c-terminal transmembrane region removed to increase solubility sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 508004 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain EDIIRNIARHL AQVGDSMDR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P55957:p.[Leu90Ala;Asp95Ala] mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bcl-2 was removed to improve solubility but they do not give the residues. The position of this region was taken from the Uniprot annotation. bcl2-bad 508001 N/A 508003 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal protein with c-terminal transmembrane region removed to increase solubility sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false ecobb Escherichia coli (strain B / BL21) N/A 508005 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain LWAAQRYGRE LRRMSDEFEG SFKGL sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bcl-2 was removed to improve solubility but they do not give the residues. The position of this region was taken from the Uniprot annotation. Note that the Interpro entry for BH domain states that Bad does not contain a BH3 domain. bcl2-bim-alpha1 508001 N/A 508003 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal protein with c-terminal transmembrane region removed to increase solubility sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false ecobb Escherichia coli (strain B / BL21) n/a 508006 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain MRPEIWIAQELRRIGDEFNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1 B, 3 B The authors state that the c-terminal transmembrane region of Bcl-2 was removed to improve solubility but they do not give the residues. The position of this region was taken from the Uniprot annotation. The Kd is under 1.0 E-8 M. BAD BH3 domain displaces BIM BH3 from Bcl-2 (but NOXA A BH3 does not). bcl2-bik 508001 N/A 508007 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain MEGSDALALRLACIGDEMDV sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 508003 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal protein with c-terminal transmembrane region removed to increase solubility sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bcl-2 was removed to improve solubility but they do not give the residues. The position of this region was taken from the Uniprot annotation. bcl2-bbc3 508001 N/A 508003 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal protein with c-terminal transmembrane region removed to increase solubility sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false ecobb Escherichia coli (strain B / BL21) N/A 508008 unspecified role unspecified role neutral component neutral component n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region peptide containing BH3 domain EQWAREIGAQLRRMADDLNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bcl-2 was removed to improve solubility but they do not give the residues. The position of this region was taken from the Uniprot annotation. bcl2-bmf 508001 N/A 508009 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain HQAEVQIARKLQLIADQFHR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 508003 unspecified role unspecified role neutral component neutral component n-terminal protein with c-terminal transmembrane region removed to increase solubility sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bcl-2 was removed to improve solubility but they do not give the residues. The position of this region was taken from the Uniprot annotation. Note this peptide has an extra HisGln at the n-terminus and at position 140 a Leu instead of a Cys. bcl2l2-bid 508001 N/A 508004 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain EDIIRNIARHL AQVGDSMDR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P55957:p.[Leu90Ala;Asp95Ala] mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 508010 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bcl-w was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. The Kd is under 1.0 E-8 M. bcl2l1-bim-alpha1 508001 N/A 508011 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) n/a 508006 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain MRPEIWIAQELRRIGDEFNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bcl-XL was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. The Kd is under 1.0 E-8 M. bcl2l1-bad 508001 N/A 508005 unspecified role unspecified role neutral component neutral component n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region peptide containing BH3 domain LWAAQRYGRELRRMSDEFEGSFKGL sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 508011 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bcl-XL was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. The Kd is under 10 E-8 M. Note that the Interpro entry for BH domain states that Bad does not contain a BH3 domain. bcl2l1-bik-1 508001 N/A 508011 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 508007 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain MEGSDALALRLACIGDEMDV sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bcl-XL was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. bcl2l1-hrk 508001 N/A 508012 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain SSAAQLTAARLKALGDELHQ sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 508011 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bcl-XL was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. BCL-XL is the only protein tested here that binds HRK BH3. bcl2l1-bbc3 508001 N/A 508011 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 508008 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain EQWAREIGAQLRRMADDLNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bcl-XL was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. The Kd is less than 1.0 E-8 M. bcl2l1-bmf 508001 N/A 508009 unspecified role unspecified role neutral component neutral component n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region peptide containing BH3 domain HQAEVQIARKLQLIADQFHR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 508011 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bcl-XL was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. Note this peptide has an extra HisGln at the n-terminus and at position 140 a Leu instead of a Cys. The Kd is less than 1.0 E-8 M. bcl2l1-bid-1 508001 N/A 508004 unspecified role unspecified role neutral component neutral component n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P55957:p.[Leu90Ala;Asp95Ala] mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region peptide containing BH3 domain EDIIRNIARHL AQVGDSMDR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 508011 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bcl-XL was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. bcl2l2-bim-alpha1 508001 N/A 508010 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) n/a 508006 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain MRPEIWIAQELRRIGDEFNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bcl-w was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. bcl2l2-bad 508001 N/A 508005 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain LWAAQRYGRE LRRMSDEFEG SFKGL sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 508010 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bcl-w was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. Note that the Interpro entry for BH domain states that Bad does not contain a BH3 domain. bcl2l2-bik 508001 N/A 508010 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 508007 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain MEGSDALALRLACIGDEMDV sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bcl-w was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. bcl2l2-bbc3 508001 N/A 508010 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 508008 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain EQWAREIGAQLRRMADDLNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bcl-w was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. bcl2l2-bmf 508001 N/A 508009 unspecified role unspecified role neutral component neutral component n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region peptide containing BH3 domain HQAEVQIARKLQLIADQFHR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 508010 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bcl-w was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. Note this peptide has an extra HisGln at the n-terminus and at position 140 a Leu instead of a Cys. mcl1-bid 508001 N/A 508004 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain EDIIRNIARHL AQVGDSMDR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P55957:p.[Leu90Ala;Asp95Ala] mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 508013 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Mcl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. The Kd is under 1.0 E-8 M. mcl1-bim-alpha1 508001 N/A 508013 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) n/a 508006 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain MRPEIWIAQELRRIGDEFNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1 B, 3 B The authors state that the c-terminal transmembrane region of Mcl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. The Kd is under 1.0 E-8 M. NOXA A BH3 displaces BIM from Mcl-1, (but BAD BH3 does not). mcl1-bik 508001 N/A 508013 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 508007 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain MEGSDALALRLACIGDEMDV sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Mcl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. mcl1- pmaip1 508001 N/A 508013 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 508014 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain AELPPEFAAQLRKIGDKVYC (NOXA A) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Mcl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. mcl1- pmaip1-1 508001 N/A 508013 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 508014 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain PADLKDECAQLRRIGDKVNL (NOXA B) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Mcl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. mcl1-bbc3 508001 N/A 508013 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 508008 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain EQWAREIGAQLRRMADDLNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Mcl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. The Kd is less than 1.0 E-8 M. mcl1-bmf 508001 N/A 508013 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 508009 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain HQAEVQIARKLQLIADQFHR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Mcl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. Note this peptide has an extra HisGln at the n-terminus and at position 140 a Leu instead of a Cys. bcl2a1-bid 508001 N/A 508015 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 508004 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain EDIIRNIARHL AQVGDSMDR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P55957:p.[Leu90Ala;Asp95Ala] mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bfl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. bcl2a1-bim-alpha1 508001 n/a 508006 unspecified role unspecified role neutral component neutral component n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region peptide containing BH3 domain MRPEIWIAQELRRIGDEFNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 508015 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bfl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. bcl2a1-bbc3 508001 N/A 508008 unspecified role unspecified role neutral component neutral component n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region peptide containing BH3 domain EQWAREIGAQLRRMADDLNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 508015 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1 B The authors state that the c-terminal transmembrane region of Bfl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. BFL-1 is distinct as while it binds BID and BIM, it binds only PUMA among the sensitizers tested. bcl2l2-bid-1 508002 N/A 508016 unspecified role unspecified role prey prey c-terminal Bid was cleaved by caspase 8 to yield tBid (c-terminal fragment) sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P70444:p.[Cys30Ser;Cys126Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 508010 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q92843:p.Arg95Pro mutation in the BH1 domain mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 3 A The authors state that the c-terminal transmembrane region of Bcl-w was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. The site cleaved in murine Bid by caspase 8 to yield tBid is suggested to be Asp59 by the literature. The BH3 domains of Bad, Bik, Puma and Bmf are able to displace tBid from Bcl-w.