IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ boosen-2005-1 Par-4-mediated recruitment of Amida to the actin cytoskeleton leads to the induction of apoptosis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Boosen M., Vetterkind S., Koplin A., Illenberger S., Preuss U. Apoptosis - Interactions involving proteins with a function related to apoptosis The source of Par-4 was taken from PMID 8043520. A cDNA library generated from SV52 cells was used. SV52 cells are SV40 large T-transformed rat embryo fibroblasts. Exp. Cell Res. (0014-4827) 2005 Cancer - Interactions investigated in the context of cancer boosen-2005-2 Par-4-mediated recruitment of Amida to the actin cytoskeleton leads to the induction of apoptosis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Boosen M., Vetterkind S., Koplin A., Illenberger S., Preuss U. Apoptosis - Interactions involving proteins with a function related to apoptosis The source of Par-4 was taken from PMID 8043520. A cDNA library generated from SV52 cells was used. SV52 cells are SV40 large T-transformed rat embryo fibroblasts. Exp. Cell Res. (0014-4827) 2005 Cancer - Interactions investigated in the context of cancer boosen-2005-3 Par-4-mediated recruitment of Amida to the actin cytoskeleton leads to the induction of apoptosis. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Boosen M., Vetterkind S., Koplin A., Illenberger S., Preuss U. Apoptosis - Interactions involving proteins with a function related to apoptosis The source of Par-4 was taken from PMID 8043520. A cDNA library generated from SV52 cells was used. SV52 cells are SV40 large T-transformed rat embryo fibroblasts. Exp. Cell Res. (0014-4827) 2005 Cancer - Interactions investigated in the context of cancer boosen-2005-4 Par-4-mediated recruitment of Amida to the actin cytoskeleton leads to the induction of apoptosis. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Boosen M., Vetterkind S., Koplin A., Illenberger S., Preuss U. Apoptosis - Interactions involving proteins with a function related to apoptosis The source of Par-4 was taken from PMID 8043520. A cDNA library generated from SV52 cells was used. SV52 cells are SV40 large T-transformed rat embryo fibroblasts. Exp. Cell Res. (0014-4827) 2005 Cancer - Interactions investigated in the context of cancer boosen-2005-5 Par-4-mediated recruitment of Amida to the actin cytoskeleton leads to the induction of apoptosis. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Boosen M., Vetterkind S., Koplin A., Illenberger S., Preuss U. Apoptosis - Interactions involving proteins with a function related to apoptosis The source of Par-4 was taken from PMID 8043520. A cDNA library generated from SV52 cells was used. SV52 cells are SV40 large T-transformed rat embryo fibroblasts. Exp. Cell Res. (0014-4827) 2005 Cancer - Interactions investigated in the context of cancer boosen-2005-6 Par-4-mediated recruitment of Amida to the actin cytoskeleton leads to the induction of apoptosis. rat-ref52 Rattus norvegicus embryonic fibroblast cells ref52 Rattus norvegicus embryonic fibroblast cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Boosen M., Vetterkind S., Koplin A., Illenberger S., Preuss U. Apoptosis - Interactions involving proteins with a function related to apoptosis The source of Par-4 was taken from PMID 8043520. A cDNA library generated from SV52 cells was used. SV52 cells are SV40 large T-transformed rat embryo fibroblasts. Exp. Cell Res. (0014-4827) 2005 Cancer - Interactions investigated in the context of cancer boosen-2005-7 Par-4-mediated recruitment of Amida to the actin cytoskeleton leads to the induction of apoptosis. rat-ref52 Rattus norvegicus embryonic fibroblast cells ref52 Rattus norvegicus embryonic fibroblast cell line fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Boosen M., Vetterkind S., Koplin A., Illenberger S., Preuss U. Apoptosis - Interactions involving proteins with a function related to apoptosis The source of Par-4 was taken from PMID 8043520. A cDNA library generated from SV52 cells was used. SV52 cells are SV40 large T-transformed rat embryo fibroblasts. Exp. Cell Res. (0014-4827) 2005 Cancer - Interactions investigated in the context of cancer pawr_rat PRKC apoptosis WT1 regulator protein Prostate apoptosis response 4 protein Transcriptional repressor Par-4-like protein PAWR Pawr Par4 protein protein rat Rattus norvegicus (Rat) Rat MATGGYRSSGSTTDFLEEWKAKREKMRAKQNPVGPGSSGGDPAAKSPAGPLAQTTAAGTSELNHGPAGAAAPAAPGPGALNCAHGSSALPRGAPGSRRPEDECPIAAGAAGAPASRGDEEEPDSAPEKGRSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAASLPDPGTSYLPQDPSRTVPGRYKSTISAPEEEILNRYPRTDRSGFSRHNRDTSAPANFASSSTLEKRIEDLEKEVLRERQENLRLTRLMQDKEEMIGKLKEEIDLLNRDLDDMEDENEQLKQENKTLLKVVGQLTR tfpt_rat TCF3 fusion partner homolog Tfpt Amida Protein amida protein protein rat Rattus norvegicus (Rat) Rat MELEQREGTMAAVGFEEFSAPPGSELALPPLFGGHILESELETEVEFVSGGLGDSGLRERDEEEEAARGRRRRQRELNRRKYQALGRRCREIEQVNERVLNRLHQVQRITRRLQQERRFLMRVLDSYGDDYRDSQFTIVLEDDGSQGTDVPTPGNVENEPPEKEGLSPPQRTTATLDPSSPAPGEGPSGRKRRRAPRAASSLTPELAPVQVGAEGWGQGVIKVEEDFGFEADEALDSSWVSRGPDKLLPYPTLASPPFD pawr-pawr Par-4 (Pawr) homo-oligomerizes in a yeast two-hybrid assay 733451 N/A 733458 unspecified role unspecified role bait bait N/A 733458 unspecified role unspecified role prey prey physical association physical association false false false pawr-tfpt Par-4 (Pawr) interacts with Amida (Tfpt) in a yeast two-hybrid assay 733451 N/A 733459 unspecified role unspecified role prey prey N/A 733458 unspecified role unspecified role bait bait physical association physical association false false false pawr-tfpt-1 Par-4 (Pawr) interacts with Amida (Tfpt) in a directed yeast two-hybrid assay 733452 N/A 733459 unspecified role unspecified role prey prey c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 733458 unspecified role unspecified role bait bait physical association physical association false false false 1 B pawr-tfpt-4 Par-4 (Pawr) interacts with Amida (Tfpt) in a directed yeast two-hybrid assay 733452 N/A 733458 unspecified role unspecified role bait bait Q62627:p.[Leu295Ala;Leu316Ala;Leu330Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 733459 unspecified role unspecified role prey prey physical association physical association false false false 1 B pawr-tfpt-2 Par-4 (Pawr) pulls down Amida (Tfpt) in vitro 733453 N/A 733459 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 733458 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 2 A tfpt-pawr Par-4 (Pawr) coimmunoprecipitates with Amida (Tfpt) in CHO lysates 733454 N/A 733459 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 733458 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2 B Q62627; Q9JMG6 transfection pawr-tfpt-3 Par-4 (Pawr) coimmunoprecipitates Amida (Tfpt) in CHO lysates 733455 N/A 733459 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 733458 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2 B Q62627; Q9JMG6 transfection tfpt-pawr-1 Endogenous Par-4 (Pawr) coimmunoprecipitates with Amida (Tfpt) in REF52.2 lysates 733456 N/A 733459 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 733458 unspecified role unspecified role prey prey physical association physical association false false false 2 C Q9JMG6 transfection tfpt-pawr-2 Par-4 (Pawr) colocalizes with GFP-Amida (Tfpt) in REF52.2 cells 733457 N/A 733458 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 733459 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Q9JMG6; Q62627 transfection 4 This interaction took place at actin filaments.