UniProt UniProt http://www.uniprot.org yang-2005c-2 Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. human-du_145 Homo sapiens DU-145 prostate cancer cell line du_145 DU-145 Human prostate carcinoma established from the tumor tissue removed from the metastatic central nervous system lesion of a 69-year-old man with prostate carcinoma in 1975 confirmed as human with IEF of AST, MDH, NP Human prostate carcinoma established from the tumor tissue removed from the metastatic central nervous system lesion of a 69-year-old man with prostate carcinoma in 1975 confirmed as human with IEF of AST, MDH, NP anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu EMBO J. (0261-4189) 2005 mimix curation yang-2005c-1 Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu EMBO J. (0261-4189) 2005 mimix curation yang-2005c-3 Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu EMBO J. (0261-4189) 2005 mimix curation yang-2005c-4 Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. human-du_145 Homo sapiens DU-145 prostate cancer cell line du_145 DU-145 Human prostate carcinoma established from the tumor tissue removed from the metastatic central nervous system lesion of a 69-year-old man with prostate carcinoma in 1975 confirmed as human with IEF of AST, MDH, NP Human prostate carcinoma established from the tumor tissue removed from the metastatic central nervous system lesion of a 69-year-old man with prostate carcinoma in 1975 confirmed as human with IEF of AST, MDH, NP imaging technique imaging technique microscopy anti tag immunost anti tag immunostaining anti tag immunost Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu EMBO J. (0261-4189) 2005 mimix curation yang-2005c-5 Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. human-du_145 Homo sapiens DU-145 prostate cancer cell line du_145 DU-145 Human prostate carcinoma established from the tumor tissue removed from the metastatic central nervous system lesion of a 69-year-old man with prostate carcinoma in 1975 confirmed as human with IEF of AST, MDH, NP Human prostate carcinoma established from the tumor tissue removed from the metastatic central nervous system lesion of a 69-year-old man with prostate carcinoma in 1975 confirmed as human with IEF of AST, MDH, NP anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu EMBO J. (0261-4189) 2005 mimix curation yang-2005c-6 Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. human-jca1 Homo sapiens JCA-1 prostate cancer cells jca1 JCA1 prostate cancer cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu EMBO J. (0261-4189) 2005 mimix curation yang-2005c-7 Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. human-276b1 Homo sapiens 276B1 prostate epithelial cells 276b1 276B1 prostate epithelial cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu EMBO J. (0261-4189) 2005 mimix curation fhl2_human Four and a half LIM domains protein 2 Skeletal muscle LIM-protein 3 LIM domain protein DRAL FHL2 DRAL SLIM3 protein protein human Homo sapiens Human MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI foxo1_human Forkhead box protein O1 FOXO1 FKHR FOXO1A Forkhead box protein O1A Forkhead in rhabdomyosarcoma protein protein human Homo sapiens Human MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG sir1_human NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 SIRT1 SIR2L1 SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein human Homo sapiens Human MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS foxo1-fhl2-1 1215301 n/a 1215308 unspecified role unspecified role prey prey n/a 1215309 unspecified role unspecified role bait bait physical association physical association false false false 1A fhl2-foxo1 1215301 n/a 1215309 unspecified role unspecified role prey prey n/a 1215308 unspecified role unspecified role bait bait physical association physical association false false false 1A sirt1-foxo1 1215301 n/a 1215309 unspecified role unspecified role prey prey n/a 1215310 unspecified role unspecified role bait bait physical association physical association false false false 7A foxo1-sirt1 1215301 n/a 1215310 unspecified role unspecified role prey prey n/a 1215309 unspecified role unspecified role bait bait physical association physical association false false false 7A and 8B Enhanced by FHL2 (AC Q14192) fhl2-sirt1 1215301 n/a 1215308 unspecified role unspecified role bait bait n/a 1215310 unspecified role unspecified role prey prey physical association physical association false false false 8A sirt1-fhl2 1215301 n/a 1215310 unspecified role unspecified role bait bait n/a 1215308 unspecified role unspecified role prey prey physical association physical association false false false 8A foxo1-fhl2 1215302 n/a 1215308 unspecified role unspecified role prey prey n/a 1215309 unspecified role unspecified role bait bait physical association physical association false false false no figure fhl2-foxo1-1 1215303 n/a 1215308 unspecified role unspecified role bait bait n/a 1215309 unspecified role unspecified role prey prey physical association physical association false false false 1C fhl2-foxo1-2 1215304 n/a 1215309 unspecified role unspecified role neutral component neutral component n/a 1215308 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1B foxo1-fhl2-2 1215305 n/a 1215308 unspecified role unspecified role prey prey n/a 1215309 unspecified role unspecified role bait bait physical association physical association false false false 4C foxo1-fhl2-3 1215306 n/a 1215309 unspecified role unspecified role bait bait n/a 1215308 unspecified role unspecified role prey prey physical association physical association false false false 4C foxo1-fhl2-4 1215307 n/a 1215308 unspecified role unspecified role prey prey n/a 1215309 unspecified role unspecified role bait bait physical association physical association false false false 4C