IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mapelli-2005-1 Mechanism of CDK5/p25 binding by CDK inhibitors. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mapelli M., Massimiliano L., Crovace C., Seeliger MA., Tsai LH., Meijer L., Musacchio A. Apoptosis - Interactions involving proteins with a function related to apoptosis J. Med. Chem. (0022-2623) 2005 PDBe - Data obtained from the Protein Data Bank Europe cd5r1_human Cyclin-dependent kinase 5 activator 1 Cyclin-dependent kinase 5 regulatory subunit 1 TPKII regulatory subunit CDK5R1 CDK5R NCK5A protein protein human Homo sapiens Human MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR cdk5_human Cyclin-dependent-like kinase 5 CDK5 Cell division protein kinase 5 Tau protein kinase II catalytic subunit Serine/threonine-protein kinase PSSALRE CDKN5 protein protein human Homo sapiens Human MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP cdk5-cdk5r1-1 Structural mechanism for the inhibition of cdk5-p25 by roscovitine, aloisine and indirubin. 515603 N/A 515604 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm Stoichiometry: 2.0 N/A 515605 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm Stoichiometry: 2.0 direct interaction direct interaction false false false dimeric, multimeric working 78.41300%, free 77.51900% 2.3A cdk5-cdk5r1-2 Structural mechanism for the inhibition of cdk5-p25 by roscovitine, aloisine and indirubin. 515603 N/A 515605 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm Stoichiometry: 2.0 N/A 515604 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm Stoichiometry: 2.0 direct interaction direct interaction false false false tetrameric, multimeric working 77.11100%, free 76.95700% 2.35A cdk5-cdk5r1-3 Structural mechanism for the inhibition of cd5-p25 from the roscovitine, aloisine and indirubin. 515603 N/A 515604 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm Stoichiometry: 2.0 N/A 515605 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm Stoichiometry: 2.0 direct interaction direct interaction false false false dimeric, multimeric working 78.42500%, free 78.1300% 2.2A