IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ geisbrecht-2004-1 A role for Drosophila IAP1-mediated caspase inhibition in Rac-dependent cell migration. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Geisbrecht ER., Montell DJ. Apoptosis - Interactions involving proteins with a function related to apoptosis dmontell@jhmi.edu Cell (0092-8674) 2004 Only protein-protein interactions imex curation geisbrecht-2004-3 A role for Drosophila IAP1-mediated caspase inhibition in Rac-dependent cell migration. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Geisbrecht ER., Montell DJ. Apoptosis - Interactions involving proteins with a function related to apoptosis dmontell@jhmi.edu Cell (0092-8674) 2004 Only protein-protein interactions imex curation geisbrecht-2004-2 A role for Drosophila IAP1-mediated caspase inhibition in Rac-dependent cell migration. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. pull down pull down anti tag western anti tag western blot anti tag western Geisbrecht ER., Montell DJ. Apoptosis - Interactions involving proteins with a function related to apoptosis dmontell@jhmi.edu Cell (0092-8674) 2004 Only protein-protein interactions imex curation geisbrecht-2004-4 A role for Drosophila IAP1-mediated caspase inhibition in Rac-dependent cell migration. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. pull down pull down western blot western blot Immuno blot Immuno blot Geisbrecht ER., Montell DJ. Apoptosis - Interactions involving proteins with a function related to apoptosis dmontell@jhmi.edu Cell (0092-8674) 2004 Only protein-protein interactions imex curation prof_drome Profilin chic chi CG9553 Protein chickadee protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSSGFEVTKEELSKLISGFDQQDGLTSNGVTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDYLITCGY diap1_drome Death-associated inhibitor of apoptosis 1 Diap1 Apoptosis 1 inhibitor E3 ubiquitin-protein ligase th Iap1 Inhibitor of apoptosis 1 Protein thread th CG12284 RING-type E3 ubiquitin transferase Diap1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MASVVADLPSYGPIAFDQVDNNTNATQLFKNNINKTRMNDLNREETRLKTFTDWPLDWLDKRQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLRRRTTNNVPINAEALDRILPPISYDICGANDSTLEMREHAYAEGVIPMSQLIQSIGMNAVNAAGSVTGTAAPQPRVTVATHASTATQATGDVQPETCRPSAASGNYFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQLYIDTVAAKPVLAEEKEESSSIGGVAVASTQASEEEQQTSLSSEEAVSGDVAPSVAPTAATRIFNKIVEATAVATPSTNSSGSTSIPEEKLCKICYGAEYNTAFLPCGHVVACAKCASSVTKCPLCRKPFTDVMRVYFS rac1_drome Ras-related protein Rac1 Rac1 RacA CG2248 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRKCALL diap1-prof 803539 n/a 803543 unspecified role unspecified role prey prey drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 803544 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 6B rac1-prof-1 803539 n/a 803543 unspecified role unspecified role prey prey drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 803545 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P40792:p.Gly12Val mutation mutation certain certain sequence position certain certain certain sequence position certain false P40792:p.Thr17Asn mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 6B rac1-profilin 803540 n/a 803545 unspecified role unspecified role bait bait n/a 803543 unspecified role unspecified role prey prey physical association physical association false false false 6D rac1-profilin-1 803540 n/a 803545 unspecified role unspecified role prey prey n/a 803543 unspecified role unspecified role bait bait physical association physical association false false false 6C diap1-rac 803541 n/a 803545 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P40792:p.Gly12Val mutation mutation certain certain sequence position certain certain certain sequence position certain false P40792:p.Thr17Asn mutation mutation certain certain sequence position certain certain certain sequence position certain false n/a 803544 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 6F diap1-prof-1 803542 n/a 803544 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 803543 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 6E