IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lang-2004-4 ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk Mol. Cell. Biol. (0270-7306) 2004 lang-2004-7 ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk Mol. Cell. Biol. (0270-7306) 2004 lang-2004-2 ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk Mol. Cell. Biol. (0270-7306) 2004 lang-2004-3 ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk Mol. Cell. Biol. (0270-7306) 2004 lang-2004-1 ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH pull down pull down fingerprinting peptide massfingerprinting fingerprinting Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk Mol. Cell. Biol. (0270-7306) 2004 lang-2004-5 ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. mouse-macrophage Mus musculus macrophage macrophage Macrophage anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk Mol. Cell. Biol. (0270-7306) 2004 lang-2004-6 ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk Mol. Cell. Biol. (0270-7306) 2004 lang-2004-8 ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk Mol. Cell. Biol. (0270-7306) 2004 m3k8_human Mitogen-activated protein kinase kinase kinase 8 MAP3K8 COT ESTF Serine/threonine-protein kinase cot Cancer Osaka thyroid oncogene Tumor progression locus 2 Proto-oncogene c-Cot protein protein human Homo sapiens Human MEYMSTGSDNKEEIDLLIKHLNVSDVIDIMENLYASEEPAVYEPSLMTMCQDSNQNDERSKSLLLSGQEVPWLSSVRYGTVEDLLAFANHISNTAKHFYGQRPQESGILLNMVITPQNGRYQIDSDVLLIPWKLTYRNIGSDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQFKPSDVEIQACFRHENIAELYGAVLWGETVHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHVLKGLDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTEDVYFPKDLRGTEIYMSPEVILCRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIADDCSPGMRELIEASLERNPNHRPRAADLLKHEALNPPREDQPRCQSLDSALLERKRLLSRKELELPENIADSSCTGSTEESEMLKRQRSLYIDLGALAGYFNLVRGPPTLEYG p19838-1 Nuclear factor NF-kappa-B p105 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMMSNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMATSWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQAHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGKI tnip2_human TNFAIP3-interacting protein 2 TNIP2 ABIN2 FLIP1 Fetal liver LKB1-interacting protein A20-binding inhibitor of NF-kappa-B activation 2 protein protein human Homo sapiens Human MSRDPGSGGWEEAPRAAAALCTLYHEAGQRLRRLQDQLAARDALIARLRARLAALEGDAAPSLVDALLEQVARFREQLRRQEGGAAEAQMRQEIERLTERLEEKEREMQQLLSQPQHEREKEVVLLRRSMAEGERARAASDVLCRSLANETHQLRRTLTATAHMCQHLAKCLDERQHAQRNVGERSPDQSEHTDGHTSVQSVIEKLQEENRLLKQKVTHVEDLNAKWQRYNASRDEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQELAASRTARDAALERVQMLEQQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSWRQDSREPDAGRIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGHPGAAQRGQGDLQCPHCLQCFSDEQGEELLRHVAECCQ tnap3_human Tumor necrosis factor alpha-induced protein 3 Putative DNA-binding protein A20 Zinc finger protein A20 TNFAIP3 OTUD7C OTU domain-containing protein 7C protein protein human Homo sapiens Human MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTPMARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPKLNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASGKVSPTASRFQNTIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRPKCARASCKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCNECFQFKQMYG q00653-1 Nuclear factor NF-kappa-B p100 subunit p100 NFKB2 LYT10 DNA-binding factor KBF2 H2TF1 Lymphocyte translocation chromosome 10 protein Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 Oncogene Lyt-10 protein protein human Homo sapiens Human MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGSGGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEAAEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHLLTAQDENGDTPLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQTSVVSFLLRVGADPALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEGLYPVHLAVRARSPECLDLLVDSGAEVEATERQGGRTALHLATEMEELGLVTHLVTKLRANVNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEEPLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 m3k8_mouse Mitogen-activated protein kinase kinase kinase 8 Map3k8 Cot Serine/threonine-protein kinase cot Cancer Osaka thyroid oncogene Proto-oncogene c-Cot Tpl2 Tumor progression locus 2 protein protein mouse Mus musculus Mouse MEYMSTGSDEKEEIDLLIKHLNVSEVIDIMENLYASEEPGVYEPSLMTMYPDSNQNEERSESLLRSGQEVPWLSSVRYGTVEDLLAFANHVSNMTKHFYGRRPQECGILLNMVISPQNGRYQIDSDVLLVPWKLTYRNIGSGFVPRGAFGKVYLAQDMKTKKRMACKLIPIDQFKPSDVEIQACFRHENIAELYGAVLWGDTVHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHILKGLDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVKMTEDVYLPKDLRGTEIYMSPEVILCRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIAGDCSPGMRELIEAALERNPNHRPKAADLLKHEALNPPREDQPRCQSLDSALFERKRLLSRKELQLPENIADSSCTGSTEESEVLRRQRSLYIDLGALAGYFNIVRGPPTLEYG p25799-1 Nuclear factor NF-kappa-B p105 subunit p105 Nfkb1 DNA-binding factor KBF1 EBP-1 NF-kappa-B1 p84/NF-kappa-B1 p98 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein mouse Mus musculus Mouse MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPGPGYGYSNYGFPPYGGITFHPGVTKSNAGVTHGTINTKFKNGPKDCAKSDDEESLTLPEKETEGEGPSLPMACTKTEPIALASTMEDKEQDMGFQDNLFLEKALQLARRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHAQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRVGADLSLLDRWGNSVLHLAAKEGHDRILSILLKSRKAAPLIDHPNGEGLNAIHIAVMSNSLPCLLLLVAAGAEVNAQEQKSGRTALHLAVEYDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWEKAGEDEGVVPGTTPLDMAANWQVFDILNGKPYEPVFTSDDILPQGDMKQLTEDTRLQLCKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTIKELMEALQQMGYTEAIEVIQAAFRTPATTASSPVTTAQVHCLPLSSSSTRQHIDELRDSDSVCDSGVETSFRKLSFTESLTGDSPLLSLNKMPHGYGQEGPIEGKI tnip2_mouse TNFAIP3-interacting protein 2 Tnip2 Abin2 A20-binding inhibitor of NF-kappa-B activation 2 protein protein mouse Mus musculus Mouse MSSGDPRSGRQDGAPRAAAALCGLYHEAGQQLQRLKDQLAARDALIASLRTRLAALEGHTAPSLVDALLDQVERFREQLRRQEEGASETQLRQEVERLTERLEEKEREMQQLMSQPQHEQEKEVVLLRRSVAEKEKARAASDVLCRSLADETHQLRRTLAATAHMCQHLAKCLDERQCAQGDAGEKSPAELEQTSSDASGQSVIKKLQEENRLLKQKVTHVEDLNAKWQRYDASRDEYVKGLHAQLKRRQVPLEPELMKKEISRLNRQLEEKISDCAEANQELTAMRMSRDTALERVQMLEQQILAYKDDFKSERADRERAHSRIQELEEKIMSLMYQVSQRQDSREPGPCRIHTGNKTAKYLEMDALEHVTPGGWRPESRSQQMEPSAEGGHVCTAQRGQGDLQCPHCLRCFSDEQGEAFLRHLSECCQ mp2k1_rabit Dual specificity mitogen-activated protein kinase kinase 1 MAP2K1 MEK1 PRKMK1 ERK activator kinase 1 MAPK/ERK kinase 1 protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSAVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV nfkb1-tnip2-6 Interaction between NFKB1/p105, TNIP2 and MAP3K8 by pulldown 721846 N/A 721854 unspecified role unspecified role prey prey N/A 721855 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 721856 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) association association false false false Fig. 3C map3k8-tnip2-7 Interaction between TNIP2 and MAP3K8 by pulldown 721846 N/A 721856 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 721854 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false Fig. 3C nfkb1-tnip2-9 Interaction between NFKB1/p105 and TNIP2 by pulldown 721846 N/A 721855 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P19838-1:p.Leu841Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false death domain required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 721856 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false Fig. 5A, 5B Cell lysates were prepared using 1% Brij 58 buffer A - interaction not observed when milder conditions were used. Optimal association also requires the PEST region (893-968) and, to a lesser extent, NFKB1/p105 residues 497 to 538 map3k8-tnip2-9 Interaction between TNIP2 and MAP3K8 by pulldown 721846 N/A 721856 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 721854 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 5E map3k8-tnip2-8 Interaction between TNIP2 and MAP3K8 by pulldown 721847 N/A 721854 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 721856 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false Fig. 5D nfkb1-tnip2-11 Interaction between NFKB1/p105 and TNIP2 by pulldown 721847 N/A 721856 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 721855 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false Fig. 6A, 6B, 6C map3k8-tnip2-10 Interaction between TNIP2 and MAP3K8 by pulldown 721847 N/A 721856 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 721854 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false Fig. 6A, 6B, 6C tnfaip3-tnip2-1 Interaction between TNFAIP3 and TNIP2 by pulldown 721847 N/A 721857 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 721856 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false Fig. 6A, 6B nfkb1-tnip2-2 Interaction between NFKB1/p105, NFKB2/p100, TNIP2 and MAP3K8 by coimmunoprecipitation 721848 N/A 721855 unspecified role unspecified role bait bait N/A 721854 unspecified role unspecified role prey prey N/A 721858 unspecified role unspecified role prey prey N/A 721856 unspecified role unspecified role prey prey association association false false false Fig. 1C nfkb1-tnip2-3 Interaction between NFKB1/p105, TNIP2 and MAP3K8 by coimmunoprecipitation 721848 N/A 721854 unspecified role unspecified role bait bait N/A 721856 unspecified role unspecified role prey prey N/A 721855 unspecified role unspecified role prey prey association association false false false Fig. 1C nfkb1-tnip2-4 Interaction between NFKB1/p105, TNIP2 and MAP3K8 by coimmunoprecipitation 721848 N/A 721856 unspecified role unspecified role bait bait N/A 721854 unspecified role unspecified role prey prey N/A 721855 unspecified role unspecified role prey prey association association false false false Fig. 1C nfkb1-tnip2-5 Interaction between NFKB1/p105 and TNIP2 by coimmunoprecipitation 721849 N/A 721856 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 721855 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2A and 2C Removal of endogenous MAP3K8 from 293 cell lysates did not reduce the level of TNIP2 which coimmunoprecipitated with NFKB1/p105 map3k8-tnip2-6 Interaction between TNIP2 and MAP3K8 by coimmunoprecipitation 721849 N/A 721854 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 721856 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 2B and 2D Immunodepletion of endogenous p105 with anti-p105C antibody did not alter binding of TNIP2 to MAP3K8 nfkb1-tnip2-1 Identification of proteins interacting with NFKB1/p105 by pulldown 721850 N/A 721856 unspecified role unspecified role prey prey N/A 721858 unspecified role unspecified role prey prey N/A 721859 unspecified role unspecified role prey prey N/A 721855 unspecified role unspecified role bait bait P19838-1:p.Ser927Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 1 nfkb1-tnip2-8 Interaction between Nfkb1/p105, Map3k8 and Tnip1 identified by coimmunoprecipitation 721851 N/A 721860 unspecified role unspecified role prey prey N/A 721861 unspecified role unspecified role prey prey N/A 721862 unspecified role unspecified role bait bait association association false false false Fig. 4A TNIP2 immunodepletion removed the majority of MAP3K8 detected directly in cell lysates or after reimmunoprecipitation with anti-TNIP2 or anti-NFKB1/p105 antibodies. Immunodepletion of p105 using anti-NFKB1/p105C antibody also removed a substantial fraction of TNIP2 and cleared MAP3K8 from lysates. nfkb1-tnip2-10 Interaction between NFKB1/p105 and TNIP2 by pulldown 721852 N/A 721856 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 721855 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Fig. 5C map2k1-map3k8-1 Phosphorylation of rabbit MAP2K1 by human MAP3K8 721853 N/A 721854 enzyme enzyme neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 721863 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P29678:p.Lys205Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation false false false Phosphorylation of MAP2K1 Fig. 9E Mutated lysine in MAP2K1 is at position 205 in the rabbit sequence, not 207 as given in the paper.